BP916715
Clone id YMU001_000090_G01
Library
Length 555
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000090_G01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATTCATGATAACTTTAAAAGCAACCGTGTTCGACGAGAGCACAAACATTTCAACTATGTG
CACCATAAAAGGAGAGAAATCCCAAACCATCATGGAAAACGTGAACAACTTGAAGTAGCT
AGAGAGAAGCAAAGCAAGTAACAAATCTACCCACCTAAGCTTTGGATGTGAACGAGTTCG
CAAGATGACTACTGCAGCCACTAATATTGTTGAGAAGTAAATAAGATTTTGCACCAACAC
TTGTCCAATAAGCTTTCCAGCAGTAGAAACAAAAGCTGGCAAGCTATCCCATTTGATTGT
GCCCACCTTCCCTGCACTGGTCAGTGATTGTCTACAAGAGTCCAGTAGCAGGAAAAGTAG
GCATGTTTTCCAAACCAGGTCCATCATTTCACACTCCACGTACTCATCCGCCACACACTT
GCACTCCATGCATTTCGTGAGACGGATGTGGCCAGGAGAATAGTGAAGATAAACCTCGTT
GATTGCTGCTCCGCAGTGAACGCAGCACATGGAGTTCTCGAGCGCATCCTCTCTCATTTC
CTAGCGCTGAGTAGC
■■Homology search results ■■ -
sp_hit_id Q54GD9
Definition sp|Q54GD9|ARV1_DICDI Protein arv1 homolog OS=Dictyostelium discoideum
Align length 204
Score (bit) 58.2
E-value 3.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916715|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_G01.
(541 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q54GD9|ARV1_DICDI Protein arv1 homolog OS=Dictyostelium disco... 58 3e-08
sp|Q9HDX5|ARV1_SCHPO Protein arv1 OS=Schizosaccharomyces pombe G... 54 5e-07
sp|Q3SZW3|ARV1_BOVIN Protein ARV1 OS=Bos taurus GN=ARV1 PE=2 SV=1 48 3e-05
sp|Q750Q7|ARV1_ASHGO Protein ARV1 OS=Ashbya gossypii GN=ARV1 PE=... 42 0.001
sp|Q9H2C2|ARV1_HUMAN Protein ARV1 OS=Homo sapiens GN=ARV1 PE=2 SV=1 41 0.003
sp|Q9D0U9|ARV1_MOUSE Protein ARV1 OS=Mus musculus GN=Arv1 PE=2 SV=1 41 0.004
sp|Q06541|ARV1_YEAST Protein ARV1 OS=Saccharomyces cerevisiae GN... 39 0.013
sp|P53407|ISL2B_DANRE Insulin gene enhancer protein isl-2b OS=Da... 32 1.5
sp|P53409|ISL3_ONCTS Insulin gene enhancer protein ISL-3 OS=Onco... 32 2.6
sp|P53406|ISL2A_DANRE Insulin gene enhancer protein isl-2a OS=Da... 32 2.6
sp|Q3M8T9|LEU3_ANAVT 3-isopropylmalate dehydrogenase OS=Anabaena... 31 3.4
sp|A2I8Z7|LHX9_ASTFA LIM/homeobox protein Lhx9 OS=Astyanax fasci... 30 5.8
sp|P50212|ISL2B_ONCTS Insulin gene enhancer protein ISL-2B (Frag... 30 5.8
sp|P53408|ISL2A_ONCTS Insulin gene enhancer protein ISL-2A OS=On... 30 5.8
sp|P61374|ISL1_RAT Insulin gene enhancer protein ISL-1 OS=Rattus... 30 5.8
sp|P61372|ISL1_MOUSE Insulin gene enhancer protein ISL-1 OS=Mus ... 30 5.8
sp|P61373|ISL1_MESAU Insulin gene enhancer protein ISL-1 OS=Meso... 30 5.8
sp|P61371|ISL1_HUMAN Insulin gene enhancer protein ISL-1 OS=Homo... 30 5.8
sp|P53405|ISL1_DANRE Insulin gene enhancer protein isl-1 OS=Dani... 30 5.8
sp|P50211|ISL1_CHICK Insulin gene enhancer protein ISL-1 OS=Gall... 30 5.8
sp|O07835|IORA_PYRKO Indolepyruvate oxidoreductase subunit iorA ... 30 7.5
sp|Q09437|YP62_CAEEL Putative serine/threonine-protein kinase B0... 30 7.6
sp|Q8AW92|LMO4A_XENLA LIM domain transcription factor LMO4-A OS=... 30 7.6
sp|Q68EY3|LHX9_XENLA LIM/homeobox protein Lhx9 OS=Xenopus laevis... 30 7.6
sp|Q80W90|LHX9_RAT LIM/homeobox protein Lhx9 OS=Rattus norvegicu... 30 7.6
sp|A2PZF9|LHX9_RANRU LIM/homeobox protein Lhx9 OS=Rana rugosa GN... 30 7.6
sp|Q9WUH2|LHX9_MOUSE LIM/homeobox protein Lhx9 OS=Mus musculus G... 30 7.6
sp|Q9NQ69|LHX9_HUMAN LIM/homeobox protein Lhx9 OS=Homo sapiens G... 30 7.6
sp|Q1LWV4|LHX9_DANRE LIM/homeobox protein Lhx9 OS=Danio rerio GN... 30 7.6
sp|Q90881|LHX9_CHICK LIM/homeobox protein Lhx9 OS=Gallus gallus ... 30 7.6

>sp|Q54GD9|ARV1_DICDI Protein arv1 homolog OS=Dictyostelium
discoideum GN=arv1 PE=3 SV=1
Length = 246

Score = 58.2 bits (139), Expect = 3e-08
Identities = 57/204 (27%), Positives = 86/204 (42%), Gaps = 40/204 (19%)
Frame = -1

Query: 496 MCCVHCGAAINEVYLHYSP---GHIRLTKCMECKCVADEYVECE----MMDLVWKTCLLF 338
M C+ CG +N+VY + G+IRLT+C C AD+YVE + +DL +
Sbjct: 1 MICIECGRPVNDVYKEFGKAGSGNIRLTRCASCNQTADKYVEYDFIIVFLDLFLHKAQAY 60

Query: 337 LLLDSCRQSLTSAG------KV--------GTIKW---------DSLPAFVSTAGK---- 239
L RQ G KV IKW S PAF +
Sbjct: 61 RHLLFNRQPYRDFGIPIQYIKVLVVYIFFESYIKWLRFKEYEQHPSGPAFYYIDWQDDVP 120

Query: 238 ------LIGQVLVQNLIYFSTILVAAVVILRTRSHPKLRWVDXXXXXXLSSYFKLFTFSM 77
+ + + +Y +I+++ I +R +P +++ LSS+ K F M
Sbjct: 121 YDRYWFIFVTAIAEFAVYILSIILSVRFIYESR-YPIIKYNYLIMAIILSSFGKGFLVLM 179

Query: 76 MVWDFSPFMVHIVEMFVLSSNTVA 5
M+WD+ I+ +FVLSSN VA
Sbjct: 180 MIWDYPFSFGSILNIFVLSSNVVA 203


>sp|Q9HDX5|ARV1_SCHPO Protein arv1 OS=Schizosaccharomyces pombe
GN=arv1 PE=2 SV=1
Length = 220

Score = 53.9 bits (128), Expect = 5e-07
Identities = 55/201 (27%), Positives = 84/201 (41%), Gaps = 37/201 (18%)
Frame = -1

Query: 496 MCCVHCGAAINEVYLHYSPG--HIRLTKCMECKCVADEYVECEM----MDL------VWK 353
M CV CGA ++ +Y +Y G +IRL +C CK AD+Y+E ++ MD+ V++
Sbjct: 1 MKCVECGAEVDSLYTYYGRGTSNIRLAQCKNCKQFADKYIELDVVLISMDVILMKPQVYR 60

Query: 352 TCLLFLLLDSCRQSLTSAGKVGT-----------IKWDSL-----------PAFVSTAGK 239
L L ++LT KV + W L PA +
Sbjct: 61 HLLFNSLSARTFRNLTKCAKVVNFCILISLFNVFLVWSRLEKRAALFPYFTPAQAFLSQP 120

Query: 238 LIGQVLVQNLIYF--STILVAAVVILRTRSHPKLRWVDXXXXXXLSSYFKLFTFSMMVWD 65
+I Q L LI +T+ +VV+L + W LSS ++ M++WD
Sbjct: 121 IIRQYLTLLLICLVETTVYQISVVLLLCLTMGWKSWTSASGAVILSSSTRMLPVFMVIWD 180

Query: 64 FS-PFMVHIVEMFVLSSNTVA 5
+ +VE VL SN A
Sbjct: 181 YDLSIAATVVEWVVLFSNVDA 201


>sp|Q3SZW3|ARV1_BOVIN Protein ARV1 OS=Bos taurus GN=ARV1 PE=2 SV=1
Length = 282

Score = 48.1 bits (113), Expect = 3e-05
Identities = 44/194 (22%), Positives = 75/194 (38%), Gaps = 35/194 (18%)
Frame = -1

Query: 490 CVHCGAAINEVYLHYSPGHIRLTKCMECKCVADEYVECE--------------------- 374
C+ C E+Y Y+ G +++T C C+ D+Y+E +
Sbjct: 45 CIECNQEAKELYRDYNHGVLKITICKSCQKPVDKYIEYDPVIILINAILCKAQAYRHILF 104

Query: 373 --MMDLVWKTCLLFLL---------LDSCRQSLTSAGKVGTIK-WDSLPAFVSTAGKLIG 230
+++ K C+ LL L QS+ + K WD F +
Sbjct: 105 NTKINMHGKLCVFCLLCEAYLRWWQLQDSSQSIDPDDFIRYAKEWDFYRMFAIAS----- 159

Query: 229 QVLVQNLIYFSTILVAAVVILRTRSHPKLRWVDXXXXXXLSSYFKLFTFSMMVW--DFSP 56
++ YF I V R+ KL + LSSY KL ++W D++P
Sbjct: 160 ---LEQTAYFIGIFAFLWVERPIRAKEKLNFTLLLKALLLSSYGKLLLIPAVIWEHDYTP 216

Query: 55 FMVHIVEMFVLSSN 14
+ ++++FVL+SN
Sbjct: 217 LCLRLIKVFVLTSN 230


>sp|Q750Q7|ARV1_ASHGO Protein ARV1 OS=Ashbya gossypii GN=ARV1 PE=3
SV=1
Length = 299

Score = 42.4 bits (98), Expect = 0.001
Identities = 17/39 (43%), Positives = 23/39 (58%)
Frame = -1

Query: 496 MCCVHCGAAINEVYLHYSPGHIRLTKCMECKCVADEYVE 380
M C++C + +Y+ Y HIRLT C +C V D YVE
Sbjct: 1 MICINCCCHVESLYVAYPGDHIRLTDCWQCGEVVDRYVE 39


>sp|Q9H2C2|ARV1_HUMAN Protein ARV1 OS=Homo sapiens GN=ARV1 PE=2 SV=1
Length = 271

Score = 41.2 bits (95), Expect = 0.003
Identities = 41/194 (21%), Positives = 72/194 (37%), Gaps = 35/194 (18%)
Frame = -1

Query: 490 CVHCGAAINEVYLHYSPGHIRLTKCMECKCVADEYVECE--------------------- 374
C+ C E+Y Y+ G +++T C C+ D+Y+E +
Sbjct: 34 CIECNQEAKELYRDYNHGVLKITICKSCQKPVDKYIEYDPVIILINAILCKAQAYRHILF 93

Query: 373 --MMDLVWKTCLLFLL---------LDSCRQSLTSAGKVGTIK-WDSLPAFVSTAGKLIG 230
+++ K C+ LL L Q+ + K WD F A
Sbjct: 94 NTQINIHGKLCIFCLLCEAYLRWWQLQDSNQNTAPDDLIRYAKEWDFYRMFAIAA----- 148

Query: 229 QVLVQNLIYFSTILVAAVVILRTRSHPKLRWVDXXXXXXLSSYFKLFTFSMMVW--DFSP 56
++ YF I V + K ++ LSSY KL ++W D++
Sbjct: 149 ---LEQTAYFIGIFTFLWVERPMTAKKKPNFILLLKALLLSSYGKLLLIPAVIWEHDYTS 205

Query: 55 FMVHIVEMFVLSSN 14
+ ++++FVL+SN
Sbjct: 206 VCLKLIKVFVLTSN 219


>sp|Q9D0U9|ARV1_MOUSE Protein ARV1 OS=Mus musculus GN=Arv1 PE=2 SV=1
Length = 266

Score = 40.8 bits (94), Expect = 0.004
Identities = 44/204 (21%), Positives = 78/204 (38%), Gaps = 38/204 (18%)
Frame = -1

Query: 511 ALENSMC---CVHCGAAINEVYLHYSPGHIRLTKCMECKCVADEYVECE----------- 374
A +S C C+ C E+Y YS G +++T C C+ D+Y+E +
Sbjct: 19 AATSSSCLYRCIECNREAQELYRDYSHGVLKITICKSCQKPVDKYIEYDPVIILINAILC 78

Query: 373 ------------MMDLVWKTCLLFLLLDS------CRQSLTSAGKVGTIK----WDSLPA 260
+++ K C+ LL ++ + S S I+ WD
Sbjct: 79 KTQAYRHILFNTKINIHGKLCMFCLLCEAYLRWWQLQDSSQSPAPDDVIRYAKEWDFYRM 138

Query: 259 FVSTAGKLIGQVLVQNLIYFSTILVAAVVILRTRSHPKLRWVDXXXXXXLSSYFKLFTFS 80
FV + + + + I V + +V LSSY KL
Sbjct: 139 FVIAS--------FEQAAFLTGIFAFLWVQQPMTAKRAPDFVLLLKALLLSSYGKLLLIP 190

Query: 79 MMVW--DFSPFMVHIVEMFVLSSN 14
++W D++P + ++++FVL+SN
Sbjct: 191 AVIWEHDYTPLCLRLIKVFVLTSN 214


>sp|Q06541|ARV1_YEAST Protein ARV1 OS=Saccharomyces cerevisiae
GN=ARV1 PE=1 SV=1
Length = 321

Score = 39.3 bits (90), Expect = 0.013
Identities = 16/41 (39%), Positives = 24/41 (58%)
Frame = -1

Query: 496 MCCVHCGAAINEVYLHYSPGHIRLTKCMECKCVADEYVECE 374
M C+ C ++ +Y YS HI+LT C C+ D+YVE +
Sbjct: 1 MICITCMRPVDSLYTVYSNDHIQLTDCPYCQETVDKYVEID 41


>sp|P53407|ISL2B_DANRE Insulin gene enhancer protein isl-2b OS=Danio
rerio GN=isl2b PE=2 SV=1
Length = 358

Score = 32.3 bits (72), Expect = 1.5
Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 4/46 (8%)
Frame = -1

Query: 490 CVHCGAAINEVY-LHYSPG---HIRLTKCMECKCVADEYVECEMMD 365
CV CG+ I++ Y L SP H KC+EC DE C + D
Sbjct: 27 CVGCGSQIHDQYILRVSPDLEWHAACLKCVECNQYLDETCTCFVRD 72


>sp|P53409|ISL3_ONCTS Insulin gene enhancer protein ISL-3
OS=Oncorhynchus tschawytscha GN=isl3 PE=2 SV=1
Length = 363

Score = 31.6 bits (70), Expect = 2.6
Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 4/46 (8%)
Frame = -1

Query: 490 CVHCGAAINEVY-LHYSPG---HIRLTKCMECKCVADEYVECEMMD 365
CV CG+ I++ Y L SP H KC EC DE C + D
Sbjct: 27 CVGCGSQIHDQYILRVSPDLEWHAACLKCAECSQYLDETCTCFVRD 72


>sp|P53406|ISL2A_DANRE Insulin gene enhancer protein isl-2a OS=Danio
rerio GN=isl2a PE=2 SV=1
Length = 359

Score = 31.6 bits (70), Expect = 2.6
Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 4/46 (8%)
Frame = -1

Query: 490 CVHCGAAINEVY-LHYSPG---HIRLTKCMECKCVADEYVECEMMD 365
CV CG+ I++ Y L SP H KC EC DE C + D
Sbjct: 27 CVGCGSQIHDQYILRVSPDLEWHAACLKCAECSQYLDETCTCFVRD 72


tr_hit_id B6TMH1
Definition tr|B6TMH1|B6TMH1_MAIZE Putative uncharacterized protein OS=Zea mays
Align length 192
Score (bit) 116.0
E-value 9.0e-25
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916715|Adiantum capillus-veneris mRNA, clone:
YMU001_000090_G01.
(541 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6TMH1|B6TMH1_MAIZE Putative uncharacterized protein OS=Zea m... 116 9e-25
tr|B4FMA7|B4FMA7_MAIZE Putative uncharacterized protein OS=Zea m... 116 9e-25
tr|A9S9K0|A9S9K0_PHYPA Predicted protein (Fragment) OS=Physcomit... 105 2e-21
tr|B8AKW8|B8AKW8_ORYSI Putative uncharacterized protein OS=Oryza... 100 5e-20
tr|Q9M127|Q9M127_ARATH Putative uncharacterized protein AT4g0151... 92 2e-17
tr|Q5MK23|Q5MK23_ARATH ARV2 OS=Arabidopsis thaliana GN=ARV2 PE=2... 91 3e-17
tr|Q5MK24|Q5MK24_ARATH ARV1 OS=Arabidopsis thaliana GN=ARV1 PE=2... 88 3e-16
tr|Q2L6T8|Q2L6T8_ARATH Uncharacterized protein At1g01020.2 OS=Ar... 70 5e-11
tr|Q94GH6|Q94GH6_ORYSA Putative uncharacterized protein OSJNBb00... 69 2e-10
tr|Q10CF8|Q10CF8_ORYSJ Transmembrane ARV1-like family protein, p... 69 2e-10
tr|Q0DN02|Q0DN02_ORYSJ Os03g0784300 protein OS=Oryza sativa subs... 69 2e-10
tr|Q9MAN2|Q9MAN2_ARATH T25K16.2 OS=Arabidopsis thaliana PE=4 SV=1 65 2e-09
tr|A8WFV2|A8WFV2_DANRE Zgc:171813 OS=Danio rerio GN=zgc:171813 P... 55 2e-06
tr|Q4RF61|Q4RF61_TETNG Chromosome 14 SCAF15120, whole genome sho... 52 2e-05
tr|B7PSH5|B7PSH5_IXOSC Arv1, putative OS=Ixodes scapularis GN=Is... 52 2e-05
tr|Q0WRA1|Q0WRA1_ARATH Putative uncharacterized protein At1g0102... 50 1e-04
tr|A7R7C3|A7R7C3_VITVI Chromosome undetermined scaffold_1678, wh... 48 3e-04
tr|Q6CQA4|Q6CQA4_KLULA KLLA0D18601p OS=Kluyveromyces lactis GN=K... 48 4e-04
tr|B6VBQ6|B6VBQ6_9PELO Putative uncharacterized protein OS=Caeno... 47 6e-04
tr|A7QYH9|A7QYH9_VITVI Chromosome undetermined scaffold_247, who... 45 0.002
tr|Q2LYK6|Q2LYK6_DROPS GA16907 OS=Drosophila pseudoobscura pseud... 44 0.007
tr|Q8IJT2|Q8IJT2_PLAF7 Putative uncharacterized protein OS=Plasm... 43 0.012
tr|Q6BZW9|Q6BZW9_YARLI YALI0F30283p OS=Yarrowia lipolytica GN=YA... 43 0.012
tr|Q4XHS5|Q4XHS5_PLACH Putative uncharacterized protein (Fragmen... 42 0.021
tr|B3M6I1|B3M6I1_DROAN GF10706 OS=Drosophila ananassae GN=GF1070... 42 0.021
tr|B6MMF2|B6MMF2_BRAFL Putative uncharacterized protein OS=Branc... 41 0.036
tr|A8KAI4|A8KAI4_HUMAN cDNA FLJ75388, highly similar to Homo sap... 41 0.036
tr|Q0VBH5|Q0VBH5_MOUSE ARV1 homolog (Yeast) OS=Mus musculus GN=A... 41 0.046
tr|B4QK56|B4QK56_DROSI GD12111 OS=Drosophila simulans GN=GD12111... 41 0.046
tr|B4IAR1|B4IAR1_DROSE GM22132 OS=Drosophila sechellia GN=GM2213... 41 0.046

>tr|B6TMH1|B6TMH1_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 237

Score = 116 bits (290), Expect = 9e-25
Identities = 68/192 (35%), Positives = 102/192 (53%), Gaps = 30/192 (15%)
Frame = -1

Query: 490 CVHCGAAINEVYLHYSPGHIRLTKCMECKCVADEYVECEMM----DLV------------ 359
CV CG + +++ YSPG+IRL KC +CK VAD Y+ECE M DLV
Sbjct: 13 CVGCGGRVKTLFVQYSPGNIRLMKCDKCKAVADPYIECEFMIILIDLVLHKTRAYHHVLF 72

Query: 358 --------------WKTCLLFLLLDSCRQSLTSAGKVGTIKWDSLPAFVSTAGKLIGQVL 221
+++ L+ + LD+ R S + + G S+ + VS +++G L
Sbjct: 73 NKLSMGSSVDKGILYRSTLIHIALDTFRISFSKGNRAGGASSRSIFSTVSNCTEVVGDAL 132

Query: 220 VQNLIYFSTILVAAVVILRTRSHPKLRWVDXXXXXXLSSYFKLFTFSMMVWDFSPFMVHI 41
+ N+++ +L+ L+ S +R+ D +SSYFKLF F+MMVW+F ++ I
Sbjct: 133 LGNIVFIFMLLLGVRFFLKL-SFDIIRYRDILFAVIISSYFKLFLFTMMVWEFPSSVIFI 191

Query: 40 VEMFVLSSNTVA 5
VEMFVLSSN VA
Sbjct: 192 VEMFVLSSNVVA 203


>tr|B4FMA7|B4FMA7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 237

Score = 116 bits (290), Expect = 9e-25
Identities = 68/192 (35%), Positives = 102/192 (53%), Gaps = 30/192 (15%)
Frame = -1

Query: 490 CVHCGAAINEVYLHYSPGHIRLTKCMECKCVADEYVECEMM----DLV------------ 359
CV CG + +++ YSPG+IRL KC +CK VAD Y+ECE M DLV
Sbjct: 13 CVGCGGRVKTLFVQYSPGNIRLMKCDKCKAVADPYIECEFMIILIDLVLHKTRAYRHVLF 72

Query: 358 --------------WKTCLLFLLLDSCRQSLTSAGKVGTIKWDSLPAFVSTAGKLIGQVL 221
+++ L+ + LD+ R S + + G S+ + VS +++G L
Sbjct: 73 NKLSMGSSVDKGILYRSTLIHIALDTFRISFSKGNRAGGASSRSIFSTVSNCTEVVGDAL 132

Query: 220 VQNLIYFSTILVAAVVILRTRSHPKLRWVDXXXXXXLSSYFKLFTFSMMVWDFSPFMVHI 41
+ N+++ +L+ L+ S +R+ D +SSYFKLF F+MMVW+F ++ I
Sbjct: 133 LGNIVFIFMLLLGVRFFLKL-SFDIIRYRDILFAVIISSYFKLFLFTMMVWEFPSSVIFI 191

Query: 40 VEMFVLSSNTVA 5
VEMFVLSSN VA
Sbjct: 192 VEMFVLSSNVVA 203


>tr|A9S9K0|A9S9K0_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_17221 PE=4 SV=1
Length = 185

Score = 105 bits (261), Expect = 2e-21
Identities = 69/181 (38%), Positives = 96/181 (53%), Gaps = 19/181 (10%)
Frame = -1

Query: 490 CVHCGAAINEVYLHYSPGHIRLTKCMECKCVADEYVECEMM----DLVWKTCLLFLLLDS 323
CVHCG + VY+ YSPG+IRL++C +C VADEYVECE+M DL+ + +
Sbjct: 1 CVHCGTPVAAVYVEYSPGNIRLSECAKCGFVADEYVECEIMIVVIDLILHKPEAYRHIFF 60

Query: 322 CRQSLTSAGKVGTIKWDSLPAF--VSTAGKLIGQVLVQNLIYFSTILVAAVVI------- 170
L + + SL F V+ + V V + Y ++L + ++
Sbjct: 61 NYPLLHKLKMLVIFTFSSLFVFSIVANDSSKVLPVRVSFMSYHKSLLTSTSLLRSFLLTK 120

Query: 169 LRTRSHPKL------RWVDXXXXXXLSSYFKLFTFSMMVWDFSPFMVHIVEMFVLSSNTV 8
LRT + L RW D LSSYFK+F F+MMVW++SP M I++M VLSSNTV
Sbjct: 121 LRTYNIGILIVMGCFRWTDLLMAVALSSYFKMFVFAMMVWEYSPLMTLIIDMLVLSSNTV 180

Query: 7 A 5
A
Sbjct: 181 A 181


>tr|B8AKW8|B8AKW8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_13785 PE=4 SV=1
Length = 195

Score = 100 bits (249), Expect = 5e-20
Identities = 62/162 (38%), Positives = 90/162 (55%)
Frame = -1

Query: 490 CVHCGAAINEVYLHYSPGHIRLTKCMECKCVADEYVECEMMDLVWKTCLLFLLLDSCRQS 311
CV CG + +Y+ YSPG+IRL KC CK VAD Y+ECE M + L+ L+L R
Sbjct: 14 CVGCGRHVKTLYMQYSPGNIRLMKCDTCKAVADPYIECEFMII-----LIDLILHKTR-- 66

Query: 310 LTSAGKVGTIKWDSLPAFVSTAGKLIGQVLVQNLIYFSTILVAAVVILRTRSHPKLRWVD 131
+ ++ L + S+ K++G L+ N++ F T+L V + S R+ +
Sbjct: 67 -----AYRHLLFNKLRIY-SSLDKVLGDALLGNIV-FMTMLFLEVQFILKLSFDIRRYRE 119

Query: 130 XXXXXXLSSYFKLFTFSMMVWDFSPFMVHIVEMFVLSSNTVA 5
+SSYFKLF +MMVW+F ++ VE+ VLSSNTVA
Sbjct: 120 VLLAVIISSYFKLFLMAMMVWEFPSSVIFFVEISVLSSNTVA 161


>tr|Q9M127|Q9M127_ARATH Putative uncharacterized protein AT4g01510
OS=Arabidopsis thaliana GN=AT4g01510 PE=4 SV=1
Length = 252

Score = 91.7 bits (226), Expect = 2e-17
Identities = 65/203 (32%), Positives = 98/203 (48%), Gaps = 31/203 (15%)
Frame = -1

Query: 520 REDALENSMCCVHCGAAINEVYLHYSPGHIRLTKCMECKCVADEYVECEMM--------- 368
RE A E C V CG + +++ YSPG+ RL KC C+ VADEYVECE++
Sbjct: 23 REMAREKKTC-VECGHKVKSLFIQYSPGNFRLMKCENCEEVADEYVECELLIIFIDLILH 81

Query: 367 ---------------------DLVWKTCLLFLLLDSCRQSLTSAGKVGTIKWDSLPAFVS 251
L+WK L +LLLD+ R L G+ + +F+
Sbjct: 82 KTKAYRHLLYNVVNQESANVQHLLWKLVLAYLLLDTYRSLLLRRTNDGS---NVSMSFLF 138

Query: 250 TAGKLIGQVLVQNLIY-FSTILVAAVVILRTRSHPKLRWVDXXXXXXLSSYFKLFTFSMM 74
+ +++ VL N + FS A ++++ R L + +SSY K+F F+M
Sbjct: 139 ESLEVLVNVLSANFAFVFSFAFAAKLMLVMPRGKEILLTI------LISSYVKIFLFAMP 192

Query: 73 VWDFSPFMVHIVEMFVLSSNTVA 5
VW+F ++ IV+M VL+SN VA
Sbjct: 193 VWEFPVSVIFIVDMLVLTSNAVA 215


>tr|Q5MK23|Q5MK23_ARATH ARV2 OS=Arabidopsis thaliana GN=ARV2 PE=2
SV=1
Length = 228

Score = 91.3 bits (225), Expect = 3e-17
Identities = 61/193 (31%), Positives = 94/193 (48%), Gaps = 31/193 (16%)
Frame = -1

Query: 490 CVHCGAAINEVYLHYSPGHIRLTKCMECKCVADEYVECEMM------------------- 368
CV CG + +++ YSPG+ RL KC C+ VADEYVECE++
Sbjct: 8 CVECGHKVKSLFIQYSPGNFRLMKCENCEEVADEYVECELLIIFIDLILHKTKAYRHLLY 67

Query: 367 -----------DLVWKTCLLFLLLDSCRQSLTSAGKVGTIKWDSLPAFVSTAGKLIGQVL 221
L+WK L +LLLD+ R L G+ + +F+ + +++ VL
Sbjct: 68 NVVNQESANVQHLLWKLVLAYLLLDTYRSLLLRRTNDGS---NVSMSFLFESLEVLVNVL 124

Query: 220 VQNLIY-FSTILVAAVVILRTRSHPKLRWVDXXXXXXLSSYFKLFTFSMMVWDFSPFMVH 44
N + FS A ++++ R L + +SSY K+F F+M VW+F ++
Sbjct: 125 SANFAFVFSFAFAAKLMLVMPRGKEILLTI------LISSYVKIFLFAMPVWEFPVSVIF 178

Query: 43 IVEMFVLSSNTVA 5
IV+M VL+SN VA
Sbjct: 179 IVDMLVLTSNAVA 191


>tr|Q5MK24|Q5MK24_ARATH ARV1 OS=Arabidopsis thaliana GN=ARV1 PE=2
SV=1
Length = 245

Score = 88.2 bits (217), Expect = 3e-16
Identities = 58/192 (30%), Positives = 90/192 (46%), Gaps = 30/192 (15%)
Frame = -1

Query: 490 CVHCGAAINEVYLHYSPGHIRLTKCMECKCVADEYVECEMM------------------- 368
CV CG + +++ YSPG+IRL KC CK VADEY+ECE M
Sbjct: 8 CVGCGFRVKSLFIQYSPGNIRLMKCGNCKEVADEYIECERMIIFIDLILHRPKVYRHVLY 67

Query: 367 -----------DLVWKTCLLFLLLDSCRQSLTSAGKVGTIKWDSLPAFVSTAGKLIGQVL 221
L+WK +LLLD C +SL + P +S K++ VL
Sbjct: 68 NAINPATVNIQHLLWKLVFAYLLLD-CYRSLLLRKSDEESSFSDSPVLLSI--KVLIGVL 124

Query: 220 VQNLIYFSTILVAAVVILRTRSHPKLRWVDXXXXXXLSSYFKLFTFSMMVWDFSPFMVHI 41
N + + +A +L S + + +SSYFK+F +M+VW+F ++
Sbjct: 125 SANAAFIISFAIATKGLLNEVSRRR----EIMLGIFISSYFKIFLLAMLVWEFPMSVIFF 180

Query: 40 VEMFVLSSNTVA 5
V++ +L+SN++A
Sbjct: 181 VDILLLTSNSMA 192


>tr|Q2L6T8|Q2L6T8_ARATH Uncharacterized protein At1g01020.2
OS=Arabidopsis thaliana GN=At1g01020 PE=4 SV=1
Length = 191

Score = 70.5 bits (171), Expect = 5e-11
Identities = 51/170 (30%), Positives = 74/170 (43%), Gaps = 30/170 (17%)
Frame = -1

Query: 490 CVHCGAAINEVYLHYSPGHIRLTKCMECKCVADEYVECEMM------------------- 368
CV CG + +++ YSPG+IRL KC CK VADEY+ECE M
Sbjct: 8 CVGCGFRVKSLFIQYSPGNIRLMKCGNCKEVADEYIECERMIIFIDLILHRPKVYRHVLY 67

Query: 367 -----------DLVWKTCLLFLLLDSCRQSLTSAGKVGTIKWDSLPAFVSTAGKLIGQVL 221
L+WK +LLLD C +SL + P +S K++ VL
Sbjct: 68 NAINPATVNIQHLLWKLVFAYLLLD-CYRSLLLRKSDEESSFSDSPVLLSI--KVLIGVL 124

Query: 220 VQNLIYFSTILVAAVVILRTRSHPKLRWVDXXXXXXLSSYFKLFTFSMMV 71
N + + +A +L S + + +SSYFK+F +M+V
Sbjct: 125 SANAAFIISFAIATKGLLNEVSRRR----EIMLGIFISSYFKIFLLAMLV 170


>tr|Q94GH6|Q94GH6_ORYSA Putative uncharacterized protein
OSJNBb0093E13.16 OS=Oryza sativa GN=OSJNBb0093E13.16
PE=4 SV=1
Length = 259

Score = 68.9 bits (167), Expect = 2e-10
Identities = 46/135 (34%), Positives = 73/135 (54%)
Frame = -1

Query: 409 CKCVADEYVECEMMDLVWKTCLLFLLLDSCRQSLTSAGKVGTIKWDSLPAFVSTAGKLIG 230
CK VAD Y+ECE M + L+ L+L R + ++ L + S+ K++G
Sbjct: 105 CKAVADPYIECEFMII-----LIDLILHKTRA-------YRHLLFNKLRIY-SSLDKVLG 151

Query: 229 QVLVQNLIYFSTILVAAVVILRTRSHPKLRWVDXXXXXXLSSYFKLFTFSMMVWDFSPFM 50
L+ N+++ + + + IL+ S R+ + +SSYFKLF +MMVW+F +
Sbjct: 152 DALLGNIVFMTMLFLEVQFILKL-SFDIRRYREVLLAVIISSYFKLFLMAMMVWEFPSSV 210

Query: 49 VHIVEMFVLSSNTVA 5
+ VE+ VLSSNTVA
Sbjct: 211 IFFVEISVLSSNTVA 225


>tr|Q10CF8|Q10CF8_ORYSJ Transmembrane ARV1-like family protein,
putative (Putative uncharacterized protein) OS=Oryza
sativa subsp. japonica GN=LOC_Os03g57090 PE=4 SV=1
Length = 259

Score = 68.9 bits (167), Expect = 2e-10
Identities = 46/135 (34%), Positives = 73/135 (54%)
Frame = -1

Query: 409 CKCVADEYVECEMMDLVWKTCLLFLLLDSCRQSLTSAGKVGTIKWDSLPAFVSTAGKLIG 230
CK VAD Y+ECE M + L+ L+L R + ++ L + S+ K++G
Sbjct: 105 CKAVADPYIECEFMII-----LIDLILHKTRA-------YRHLLFNKLRIY-SSLDKVLG 151

Query: 229 QVLVQNLIYFSTILVAAVVILRTRSHPKLRWVDXXXXXXLSSYFKLFTFSMMVWDFSPFM 50
L+ N+++ + + + IL+ S R+ + +SSYFKLF +MMVW+F +
Sbjct: 152 DALLGNIVFMTMLFLEVQFILKL-SFDIRRYREVLLAVIISSYFKLFLMAMMVWEFPSSV 210

Query: 49 VHIVEMFVLSSNTVA 5
+ VE+ VLSSNTVA
Sbjct: 211 IFFVEISVLSSNTVA 225