BP916743
Clone id YMU001_000091_A10
Library
Length 382
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000091_A10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTGGTGGTGGTGGTCATGTGCTGGTTCCCCTTGTCTAACACATATGCACAATATGTATAA
AATGTAAAAAATTTTACATATTCTACACTTGAGTCCCTTCAAGTGGGTTGCCCAACCCCC
CTTGCCACAATCTGATTCACATCGGGCACCATTCCTCTATCGAAGTACAGCTTGAGCCGT
ACACCATTTACCCTATGCTTGAGAAGCTTACCATTAACTCTCACCAACTGATAGGTCCCA
TTCGGAAACGCCTTTTGCACTTTGTACAGACTGGCCCATTTCTTTTTTATCTTCTTCTGG
AAGGTGAAGTCCAAGTAGCTCTCGTATATCATTACTAGGTCTCCTTCCTCTATCCTCTTT
TCTGGAAGACTCTCATTGACTT
■■Homology search results ■■ -
sp_hit_id P07666
Definition sp|P07666|SRYA_DROME Serendipity locus protein alpha OS=Drosophila melanogaster
Align length 73
Score (bit) 31.6
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916743|Adiantum capillus-veneris mRNA, clone:
YMU001_000091_A10.
(382 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P07666|SRYA_DROME Serendipity locus protein alpha OS=Drosophi... 32 1.3
sp|Q3A5T0|F16PA_PELCD Fructose-1,6-bisphosphatase class 1 OS=Pel... 31 1.7
sp|Q6K1J1|UDB31_CANFA UDP-glucuronosyltransferase 2B31 OS=Canis ... 30 2.8
sp|P0A052|TNPA_STAAU Transposase A from transposon Tn554 OS=Stap... 29 6.3
sp|P0A051|TNPA_STAAN Transposase A from transposon Tn554 OS=Stap... 29 6.3
sp|P0A050|TNPA_STAAM Transposase A from transposon Tn554 OS=Stap... 29 6.3
sp|P26866|RT04_MARPO Ribosomal protein S4, mitochondrial OS=Marc... 29 6.3
sp|P25632|RSC6_YEAST Chromatin structure-remodeling complex prot... 29 6.3
sp|Q80T62|GP101_MOUSE Probable G-protein coupled receptor 101 OS... 29 6.3
sp|Q3UQV5|KBTB8_MOUSE Kelch repeat and BTB domain-containing pro... 29 8.2
sp|Q8NFY9|KBTB8_HUMAN Kelch repeat and BTB domain-containing pro... 29 8.2
sp|Q8TTA3|SYK1_METAC Lysyl-tRNA synthetase 1 OS=Methanosarcina a... 29 8.2
sp|Q39UC4|F16PA_GEOMG Fructose-1,6-bisphosphatase class 1 OS=Geo... 29 8.2

>sp|P07666|SRYA_DROME Serendipity locus protein alpha OS=Drosophila
melanogaster GN=Sry-alpha PE=1 SV=1
Length = 530

Score = 31.6 bits (70), Expect = 1.3
Identities = 16/73 (21%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
Frame = -3

Query: 365 PEKRIEEGDLVMIYE---SYLDFTFQKKIKKKWASLYKVQKAFPNGTYQLVRVNGKLLKH 195
P K +E+ V + + +LD +K +++ SL+ ++++F TYQL + +++H
Sbjct: 115 PVKNLEDHSFVELMDLALDHLDDYMEKLAQQRNNSLHILEESFTEDTYQLASIVNHIVRH 174

Query: 194 RVNGVRLKLYFDR 156
+ + ++ D+
Sbjct: 175 ALAFANVAIHSDK 187


>sp|Q3A5T0|F16PA_PELCD Fructose-1,6-bisphosphatase class 1
OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)
GN=fbp PE=3 SV=1
Length = 320

Score = 31.2 bits (69), Expect = 1.7
Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 3/58 (5%)
Frame = -3

Query: 275 ASLYK---VQKAFPNGTYQLVRVNGKLLKHRVNGVRLKLYFDRGMVPDVNQIVARGVG 111
AS+Y ++ + +GT + VR + NGV+L+ + G+VPD+NQ++ +G G
Sbjct: 193 ASIYAPGGLRSLYTDGTDKFVR------QLETNGVKLR--YSGGLVPDINQMLMKGKG 242


>sp|Q6K1J1|UDB31_CANFA UDP-glucuronosyltransferase 2B31 OS=Canis
familiaris GN=UGT2B31 PE=1 SV=1
Length = 530

Score = 30.4 bits (67), Expect = 2.8
Identities = 14/38 (36%), Positives = 18/38 (47%)
Frame = -3

Query: 332 MIYESYLDFTFQKKIKKKWASLYKVQKAFPNGTYQLVR 219
M+Y Y DF FQ +K W Y P Y+L+R
Sbjct: 215 MLYVLYFDFWFQTINEKSWDQFYSEVLGRPTTLYELMR 252


>sp|P0A052|TNPA_STAAU Transposase A from transposon Tn554
OS=Staphylococcus aureus GN=tnpA PE=3 SV=1
Length = 361

Score = 29.3 bits (64), Expect = 6.3
Identities = 15/39 (38%), Positives = 24/39 (61%)
Frame = +3

Query: 159 IEVQLEPYTIYPMLEKLTINSHQLIGPIRKRLLHFVQTG 275
IEV+ +PY +Y +L+K +QLI P+ K + + TG
Sbjct: 6 IEVENKPYPLYLLLDK----EYQLIEPVMKFIKYLDNTG 40


>sp|P0A051|TNPA_STAAN Transposase A from transposon Tn554
OS=Staphylococcus aureus (strain N315) GN=tnpA1 PE=3
SV=1
Length = 361

Score = 29.3 bits (64), Expect = 6.3
Identities = 15/39 (38%), Positives = 24/39 (61%)
Frame = +3

Query: 159 IEVQLEPYTIYPMLEKLTINSHQLIGPIRKRLLHFVQTG 275
IEV+ +PY +Y +L+K +QLI P+ K + + TG
Sbjct: 6 IEVENKPYPLYLLLDK----EYQLIEPVMKFIKYLDNTG 40


>sp|P0A050|TNPA_STAAM Transposase A from transposon Tn554
OS=Staphylococcus aureus (strain Mu50 / ATCC 700699)
GN=tnpA1 PE=3 SV=1
Length = 361

Score = 29.3 bits (64), Expect = 6.3
Identities = 15/39 (38%), Positives = 24/39 (61%)
Frame = +3

Query: 159 IEVQLEPYTIYPMLEKLTINSHQLIGPIRKRLLHFVQTG 275
IEV+ +PY +Y +L+K +QLI P+ K + + TG
Sbjct: 6 IEVENKPYPLYLLLDK----EYQLIEPVMKFIKYLDNTG 40


>sp|P26866|RT04_MARPO Ribosomal protein S4, mitochondrial
OS=Marchantia polymorpha GN=RPS4 PE=3 SV=2
Length = 196

Score = 29.3 bits (64), Expect = 6.3
Identities = 19/58 (32%), Positives = 34/58 (58%)
Frame = -3

Query: 371 SLPEKRIEEGDLVMIYESYLDFTFQKKIKKKWASLYKVQKAFPNGTYQLVRVNGKLLK 198
++P ++ GDL+ I E+ LDF F+ I+K + + ++++ PN + VN K LK
Sbjct: 123 NIPGFQVSNGDLISIQENSLDF-FKSNIRKNFQT-NRIRRMKPNH----LEVNYKTLK 174


>sp|P25632|RSC6_YEAST Chromatin structure-remodeling complex protein
RSC6 OS=Saccharomyces cerevisiae GN=RSC6 PE=1 SV=1
Length = 483

Score = 29.3 bits (64), Expect = 6.3
Identities = 16/47 (34%), Positives = 24/47 (51%)
Frame = -3

Query: 224 VRVNGKLLKHRVNGVRLKLYFDRGMVPDVNQIVARGVGQPT*RDSSV 84
+R+ GKLL NG F G+ D ++ G+G+ RDSS+
Sbjct: 103 LRIEGKLLHESANGKHPFSEFLEGVAVDFKRLKPLGMGKKRKRDSSL 149


>sp|Q80T62|GP101_MOUSE Probable G-protein coupled receptor 101
OS=Mus musculus GN=Gpr101 PE=2 SV=2
Length = 511

Score = 29.3 bits (64), Expect = 6.3
Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
Frame = +3

Query: 228 LIGPIRKRLLHFVQ-TGPFLFYLLLEGEVQVALVYHY*VSFLYPLFW 365
++G + R + +Q T F+F LL+ +QVALV + VS P FW
Sbjct: 51 VLGYVLHRKPNLLQVTNRFIFNLLVTDLLQVALVAPWVVSTAIPFFW 97


>sp|Q3UQV5|KBTB8_MOUSE Kelch repeat and BTB domain-containing
protein 8 OS=Mus musculus GN=Kbtbd8 PE=2 SV=1
Length = 599

Score = 28.9 bits (63), Expect = 8.2
Identities = 22/74 (29%), Positives = 33/74 (44%)
Frame = -2

Query: 342 RPSNDIRELLGLHLPEEDKKEMGQSVQSAKGVSEWDLSVGES*W*ASQA*GKWCTAQAVL 163
+P ND+RE+ L P+ D G S+ VS D W + +W + ++L
Sbjct: 317 KPPNDLREVGILVSPDNDIYIAGGYRPSSSEVSI-DHKAENDFWMYDHSTNRWLSKPSLL 375

Query: 162 R*RNGARCESDCGK 121
R R G + CGK
Sbjct: 376 RARIGCKLVYCCGK 389


tr_hit_id A5BWH5
Definition tr|A5BWH5|A5BWH5_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 73
Score (bit) 49.3
E-value 9.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916743|Adiantum capillus-veneris mRNA, clone:
YMU001_000091_A10.
(382 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5BWH5|A5BWH5_VITVI Putative uncharacterized protein OS=Vitis... 49 9e-05
tr|A5AM36|A5AM36_VITVI Putative uncharacterized protein OS=Vitis... 49 9e-05
tr|A5C1S8|A5C1S8_VITVI Putative uncharacterized protein OS=Vitis... 49 1e-04
tr|A5B6M2|A5B6M2_VITVI Putative uncharacterized protein OS=Vitis... 49 1e-04
tr|B8NZN4|B8NZN4_9APHY Predicted protein OS=Postia placenta Mad-... 48 3e-04
tr|Q7X805|Q7X805_ORYSJ OSJNBb0103I08.2 protein (OSJNBa0011L07.17... 47 4e-04
tr|Q01IP3|Q01IP3_ORYSA H0115B09.9 protein OS=Oryza sativa GN=H01... 47 4e-04
tr|A5B595|A5B595_VITVI Putative uncharacterized protein OS=Vitis... 47 4e-04
tr|A5ACM9|A5ACM9_VITVI Putative uncharacterized protein OS=Vitis... 47 4e-04
tr|A5C598|A5C598_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04
tr|A5C0U1|A5C0U1_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04
tr|A5C0Q4|A5C0Q4_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04
tr|A5BX30|A5BX30_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04
tr|A5BP37|A5BP37_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04
tr|A5AHV6|A5AHV6_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04
tr|A5AEX1|A5AEX1_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04
tr|Q45W58|Q45W58_PHACH Polyprotein (Fragment) OS=Phanerochaete c... 47 5e-04
tr|A7QXC8|A7QXC8_VITVI Chromosome undetermined scaffold_220, who... 47 6e-04
tr|A5C1S6|A5C1S6_VITVI Putative uncharacterized protein OS=Vitis... 46 8e-04
tr|A5BWA0|A5BWA0_VITVI Putative uncharacterized protein OS=Vitis... 46 8e-04
tr|A5B1Q2|A5B1Q2_VITVI Putative uncharacterized protein OS=Vitis... 46 8e-04
tr|A5ARR7|A5ARR7_VITVI Putative uncharacterized protein OS=Vitis... 46 8e-04
tr|A5C706|A5C706_VITVI Putative uncharacterized protein OS=Vitis... 46 0.001
tr|A5BG26|A5BG26_VITVI Putative uncharacterized protein OS=Vitis... 46 0.001
tr|A5B3J1|A5B3J1_VITVI Putative uncharacterized protein OS=Vitis... 46 0.001
tr|A5AQU2|A5AQU2_VITVI Putative uncharacterized protein OS=Vitis... 46 0.001
tr|A5C2M8|A5C2M8_VITVI Putative uncharacterized protein OS=Vitis... 45 0.001
tr|A5BTU4|A5BTU4_VITVI Putative uncharacterized protein OS=Vitis... 45 0.001
tr|A5BPD6|A5BPD6_VITVI Putative uncharacterized protein OS=Vitis... 45 0.001
tr|A5BA20|A5BA20_VITVI Putative uncharacterized protein OS=Vitis... 45 0.001

>tr|A5BWH5|A5BWH5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024587 PE=4 SV=1
Length = 2160

Score = 49.3 bits (116), Expect = 9e-05
Identities = 24/73 (32%), Positives = 42/73 (57%)
Frame = -3

Query: 377 NESLPEKRIEEGDLVMIYESYLDFTFQKKIKKKWASLYKVQKAFPNGTYQLVRVNGKLLK 198
++ + K +EG V++Y++ L F K+K +W + + + +PNG +L+ NGK
Sbjct: 1467 DQLISNKEFQEGQRVLLYDTRLHI-FPGKLKSRWIDPFIIHRVYPNGVVELLNSNGK-DS 1524

Query: 197 HRVNGVRLKLYFD 159
RVNG RLK + +
Sbjct: 1525 FRVNGYRLKPFME 1537


>tr|A5AM36|A5AM36_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_031936 PE=4 SV=1
Length = 1101

Score = 49.3 bits (116), Expect = 9e-05
Identities = 26/73 (35%), Positives = 41/73 (56%)
Frame = -3

Query: 377 NESLPEKRIEEGDLVMIYESYLDFTFQKKIKKKWASLYKVQKAFPNGTYQLVRVNGKLLK 198
N+ + K +EG V++Y+S L + F K+K +W Y V KA+ NG ++ N +
Sbjct: 854 NQIVLRKEFQEGQKVLLYDSKL-YIFSIKLKSRWNGPYLVHKAYSNGVVEIANPNSGCI- 911

Query: 197 HRVNGVRLKLYFD 159
+VNG RLK Y +
Sbjct: 912 FKVNGHRLKPYME 924


>tr|A5C1S8|A5C1S8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_037986 PE=4 SV=1
Length = 942

Score = 48.9 bits (115), Expect = 1e-04
Identities = 23/73 (31%), Positives = 43/73 (58%)
Frame = -3

Query: 377 NESLPEKRIEEGDLVMIYESYLDFTFQKKIKKKWASLYKVQKAFPNGTYQLVRVNGKLLK 198
++ + K ++G V++Y++ L F K+K +W + + + +PNG +L+ NGK
Sbjct: 810 DQLISNKEFQKGQRVLLYDTRLHI-FPGKLKSRWIGSFIIHQVYPNGVVELLNSNGK-DT 867

Query: 197 HRVNGVRLKLYFD 159
+VNG RLKL+ +
Sbjct: 868 FKVNGYRLKLFME 880


>tr|A5B6M2|A5B6M2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_032121 PE=4 SV=1
Length = 1730

Score = 48.9 bits (115), Expect = 1e-04
Identities = 23/73 (31%), Positives = 42/73 (57%)
Frame = -3

Query: 377 NESLPEKRIEEGDLVMIYESYLDFTFQKKIKKKWASLYKVQKAFPNGTYQLVRVNGKLLK 198
++ + K +EG V++Y++ L F +K+K +W + + + + NG +L+ NGK
Sbjct: 1643 DQLISNKEFQEGQRVLLYDTRLHI-FPRKLKSRWIGPFNIHRVYSNGVVELLNSNGK-DS 1700

Query: 197 HRVNGVRLKLYFD 159
RVNG RLK + +
Sbjct: 1701 FRVNGYRLKPFME 1713


>tr|B8NZN4|B8NZN4_9APHY Predicted protein OS=Postia placenta
Mad-698-R GN=POSPLDRAFT_100131 PE=4 SV=1
Length = 186

Score = 47.8 bits (112), Expect = 3e-04
Identities = 23/65 (35%), Positives = 39/65 (60%)
Frame = -3

Query: 350 EEGDLVMIYESYLDFTFQKKIKKKWASLYKVQKAFPNGTYQLVRVNGKLLKHRVNGVRLK 171
E G V+++E++LD K +WA Y +Q+ P+G+Y + ++G +LK V RLK
Sbjct: 44 EPGMWVLVHETWLDNQHGNKGALRWAGPYVIQERHPSGSYAIRELDGVVLKEAVAASRLK 103

Query: 170 LYFDR 156
L++ R
Sbjct: 104 LFYYR 108


>tr|Q7X805|Q7X805_ORYSJ OSJNBb0103I08.2 protein (OSJNBa0011L07.17
protein) OS=Oryza sativa subsp. japonica
GN=OSJNBb0103I08.2 PE=4 SV=1
Length = 943

Score = 47.4 bits (111), Expect = 4e-04
Identities = 23/72 (31%), Positives = 43/72 (59%)
Frame = -3

Query: 377 NESLPEKRIEEGDLVMIYESYLDFTFQKKIKKKWASLYKVQKAFPNGTYQLVRVNGKLLK 198
N+ + ++IEEGDLV+ + L+ +K++ KW + V++ G Y+L ++G+ LK
Sbjct: 873 NKKVKIRQIEEGDLVL--KKTLNEVAVEKLESKWEGPFIVKRKLETGAYKLAHLDGEELK 930

Query: 197 HRVNGVRLKLYF 162
H N + LK ++
Sbjct: 931 HTWNAISLKKFY 942


>tr|Q01IP3|Q01IP3_ORYSA H0115B09.9 protein OS=Oryza sativa
GN=H0115B09.9 PE=4 SV=1
Length = 943

Score = 47.4 bits (111), Expect = 4e-04
Identities = 23/72 (31%), Positives = 43/72 (59%)
Frame = -3

Query: 377 NESLPEKRIEEGDLVMIYESYLDFTFQKKIKKKWASLYKVQKAFPNGTYQLVRVNGKLLK 198
N+ + ++IEEGDLV+ + L+ +K++ KW + V++ G Y+L ++G+ LK
Sbjct: 873 NKKVKIRQIEEGDLVL--KKTLNEVAVEKLESKWEGPFIVKRKLETGAYKLAHLDGEELK 930

Query: 197 HRVNGVRLKLYF 162
H N + LK ++
Sbjct: 931 HTWNAISLKKFY 942


>tr|A5B595|A5B595_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_019905 PE=4 SV=1
Length = 1705

Score = 47.4 bits (111), Expect = 4e-04
Identities = 24/73 (32%), Positives = 41/73 (56%)
Frame = -3

Query: 377 NESLPEKRIEEGDLVMIYESYLDFTFQKKIKKKWASLYKVQKAFPNGTYQLVRVNGKLLK 198
++ + K +EG V++Y++ L F K+K +W + + + + NG +LV NGK
Sbjct: 1618 DQLISNKEFQEGQRVLLYDTRLHI-FPGKLKSRWIGPFIIHRVYSNGVVELVNSNGK-DS 1675

Query: 197 HRVNGVRLKLYFD 159
RVNG RLK + +
Sbjct: 1676 FRVNGYRLKPFME 1688


>tr|A5ACM9|A5ACM9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_004753 PE=4 SV=1
Length = 1669

Score = 47.4 bits (111), Expect = 4e-04
Identities = 24/73 (32%), Positives = 41/73 (56%)
Frame = -3

Query: 377 NESLPEKRIEEGDLVMIYESYLDFTFQKKIKKKWASLYKVQKAFPNGTYQLVRVNGKLLK 198
++ + K +EG V++Y++ L F K+K +W + + + F NG +L+ NGK
Sbjct: 952 DQLISNKEFQEGQRVLLYDTRLHI-FPGKLKSRWIGPFIIHRVFANGVVELLNSNGK-DS 1009

Query: 197 HRVNGVRLKLYFD 159
RVNG RLK + +
Sbjct: 1010 FRVNGYRLKPFME 1022


>tr|A5C598|A5C598_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_018580 PE=4 SV=1
Length = 717

Score = 47.0 bits (110), Expect = 5e-04
Identities = 23/73 (31%), Positives = 41/73 (56%)
Frame = -3

Query: 377 NESLPEKRIEEGDLVMIYESYLDFTFQKKIKKKWASLYKVQKAFPNGTYQLVRVNGKLLK 198
++ + K +EG V++Y+ L + F K+K +W + + + + NG +L+ NGK
Sbjct: 630 DQLISNKEFQEGQRVLLYDQRL-YIFPGKLKSRWIGPFIIHRVYSNGVVELLNSNGK-DS 687

Query: 197 HRVNGVRLKLYFD 159
RVNG RLK + +
Sbjct: 688 FRVNGYRLKPFME 700