BP916746
Clone id YMU001_000091_B01
Library
Length 171
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000091_B01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTCCCAATTGGGCATAGAAGCGGATCCGAGAAACTTGTGGGCGGAGCGCTGCATTTGAT
CTGGAGAGTGTGTGATGGCCCAATGGCATTCACAGCAAATTTTGCCTCCAAAGGGAGAAT
CTCAAAGTCTTTGAAGACCACTCCAGGATCATTTGTTCTCATGTCGAGGTT
■■Homology search results ■■ -
sp_hit_id P37327
Definition sp|P37327|YFDC_ECOLI Inner membrane protein yfdC OS=Escherichia coli (strain K12)
Align length 48
Score (bit) 30.0
E-value 3.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916746|Adiantum capillus-veneris mRNA, clone:
YMU001_000091_B01.
(171 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P37327|YFDC_ECOLI Inner membrane protein yfdC OS=Escherichia ... 30 3.7

>sp|P37327|YFDC_ECOLI Inner membrane protein yfdC OS=Escherichia
coli (strain K12) GN=yfdC PE=1 SV=1
Length = 310

Score = 30.0 bits (66), Expect = 3.7
Identities = 14/48 (29%), Positives = 25/48 (52%)
Frame = +2

Query: 17 RSGSEKLVGGALHLIWRVCDGPMAFTANFASKGRISKSLKTTPGSFVL 160
+ G ++L A+ L+W ++ A+ +KG L+ PGSF+L
Sbjct: 46 QDGEKELERDAMALLWSAIAAGLSMGASLLAKGIFQVELEGVPGSFLL 93


tr_hit_id A9TK43
Definition tr|A9TK43|A9TK43_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 54
Score (bit) 65.1
E-value 2.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916746|Adiantum capillus-veneris mRNA, clone:
YMU001_000091_B01.
(171 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TK43|A9TK43_PHYPA Predicted protein OS=Physcomitrella paten... 65 2e-09
tr|A9NWI7|A9NWI7_PICSI Putative uncharacterized protein OS=Picea... 59 9e-08
tr|Q4RPC6|Q4RPC6_TETNG Chromosome 1 SCAF15008, whole genome shot... 33 5.4

>tr|A9TK43|A9TK43_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_93801 PE=4 SV=1
Length = 317

Score = 65.1 bits (157), Expect = 2e-09
Identities = 26/54 (48%), Positives = 41/54 (75%)
Frame = -1

Query: 168 LDMRTNDPGVVFKDFEILPLEAKFAVNAIGPSHTLQIKCSAPPTSFSDPLLCPI 7
LD RTND G++FK EI PL+++F++ A+GPSH +++ AP ++FS P+L P+
Sbjct: 125 LDFRTNDLGILFKSVEISPLDSRFSITAVGPSHIVEVMAYAPYSTFSKPVLAPV 178


>tr|A9NWI7|A9NWI7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 366

Score = 59.3 bits (142), Expect = 9e-08
Identities = 26/56 (46%), Positives = 36/56 (64%)
Frame = -1

Query: 168 LDMRTNDPGVVFKDFEILPLEAKFAVNAIGPSHTLQIKCSAPPTSFSDPLLCPIGK 1
+DMR D G +F D + P E KF+ A+ PS+T+ I SA P SF +P+L P+GK
Sbjct: 257 IDMRNIDIGTMFMDIRVNPREGKFSFKAVNPSYTILITSSADPESFCEPILAPVGK 312


>tr|Q4RPC6|Q4RPC6_TETNG Chromosome 1 SCAF15008, whole genome shotgun
sequence. (Fragment) OS=Tetraodon nigroviridis
GN=GSTENG00031173001 PE=4 SV=1
Length = 804

Score = 33.5 bits (75), Expect = 5.4
Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
Frame = +2

Query: 5 PIGHRSGSEKLVGGALHL---IWRVCDGPMAFTANFASKGRISKSL 133
P SG+EK VG L IW V +GP+ T++ S G+I K+L
Sbjct: 190 PESSSSGAEKWVGEVWRLGCLIWEVFNGPLPRTSSLRSLGKIPKTL 235