BP916752
Clone id YMU001_000091_B10
Library
Length 482
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000091_B10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAGGTAGAATGTGCCACAAGATCAGACGATCGATAAGAGAATTGAAAACCAGCGGCATAG
GATCTAACAATTCTCCTGAGCCTTTGTTGTTATCTCCAAACTGAATTACTTCCTTGGAAC
TCCCGTTCATTCTTTTCTCAACTACGAATGTCTTTCCACCAAAGTTCTCCTCGCCTTCCT
GAAGACTGCAATTCCGTTATAAGAGAAGCAACTTGTGAAGCCTCATATGTGTTCAGCACA
TTTGCGTAAAGTTCCAACCCTTCAGCCACATTTACCAAACTTCCATCGACATGCTCCCAG
CACTGAAAATGTTTTGAGACTTTAATCATGGGAAGGTGTGCATCTTGTTCTTCCTTAGAA
AGAGCAGTAAAATCTGTACTGAATAGCTTTCCCCAAGAGATCCTGCAGGCTTTGGTGGCA
CATTGGAAGTCTTGCTCTCAGGATTAACAATAATTTCTTGTCCCTCTGGAGACTTCGTCA
TT
■■Homology search results ■■ -
sp_hit_id P49744
Definition sp|P49744|TSP4_RAT Thrombospondin-4 OS=Rattus norvegicus
Align length 59
Score (bit) 32.0
E-value 1.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916752|Adiantum capillus-veneris mRNA, clone:
YMU001_000091_B10.
(482 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P49744|TSP4_RAT Thrombospondin-4 OS=Rattus norvegicus GN=Thbs... 32 1.5
sp|Q9Z1T2|TSP4_MOUSE Thrombospondin-4 OS=Mus musculus GN=Thbs4 P... 32 1.5
sp|Q3SWW8|TSP4_BOVIN Thrombospondin-4 OS=Bos taurus GN=THBS4 PE=... 32 1.5
sp|Q9Y6Y1|CMTA1_HUMAN Calmodulin-binding transcription activator... 32 2.0
sp|Q5R5R2|HEAT6_PONAB HEAT repeat-containing protein 6 OS=Pongo ... 31 2.6
sp|Q6AI08|HEAT6_HUMAN HEAT repeat-containing protein 6 OS=Homo s... 31 3.4
sp|A2A891|CMTA1_MOUSE Calmodulin-binding transcription activator... 31 3.4
sp|P05990|PYR1_DROME CAD protein OS=Drosophila melanogaster GN=r... 30 7.5
sp|Q67825|POLG_HAVGB Genome polyprotein OS=Human hepatitis A vir... 30 7.5
sp|Q4U3U9|CAPSD_TNAVC Major capsid protein OS=Trichoplusia ni as... 29 9.8

>sp|P49744|TSP4_RAT Thrombospondin-4 OS=Rattus norvegicus GN=Thbs4
PE=2 SV=1
Length = 980

Score = 32.0 bits (71), Expect = 1.5
Identities = 25/59 (42%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
Frame = +1

Query: 163 SSPRL-PEDCNSVIREATCEASYVFSTFA*SSNPSATFTKLPSTCSQH*KCFETLIMGR 336
SS RL P V+ + T YV STF S SAT L S+ S + K FE +MGR
Sbjct: 55 SSQRLNPAALQPVLTDPTLHELYVISTFKLQSKSSATIFGLYSS-SDNSKYFEFTVMGR 112


>sp|Q9Z1T2|TSP4_MOUSE Thrombospondin-4 OS=Mus musculus GN=Thbs4 PE=2
SV=1
Length = 963

Score = 32.0 bits (71), Expect = 1.5
Identities = 30/84 (35%), Positives = 38/84 (45%), Gaps = 3/84 (3%)
Frame = +1

Query: 94 LQTELLPWNSRSFFS--QLRMSFHQSSPRL-PEDCNSVIREATCEASYVFSTFA*SSNPS 264
L L PW S + Q+ SS RL P V+ + T Y+ STF S S
Sbjct: 14 LHLVLQPWQRTSAQATPQVFDLLPSSSQRLNPSALQPVLTDPTLHEVYLISTFKLQSKSS 73

Query: 265 ATFTKLPSTCSQH*KCFETLIMGR 336
AT L S+ S + K FE +MGR
Sbjct: 74 ATIFGLYSS-SDNSKYFEFTVMGR 96


>sp|Q3SWW8|TSP4_BOVIN Thrombospondin-4 OS=Bos taurus GN=THBS4 PE=2
SV=1
Length = 961

Score = 32.0 bits (71), Expect = 1.5
Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
Frame = +1

Query: 163 SSPRL-PEDCNSVIREATCEASYVFSTFA*SSNPSATFTKLPSTCSQH*KCFETLIMGR 336
+S RL P ++ + T YV STF S SAT L S+ + H K FE +MGR
Sbjct: 37 ASQRLNPSVLQPILTDPTLNELYVISTFKLQSKSSATIFGLYSS-ADHSKYFEFTVMGR 94


>sp|Q9Y6Y1|CMTA1_HUMAN Calmodulin-binding transcription activator 1
OS=Homo sapiens GN=CAMTA1 PE=1 SV=4
Length = 1673

Score = 31.6 bits (70), Expect = 2.0
Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 4/76 (5%)
Frame = -1

Query: 389 KLFSTDFTALSKEEQDAHLPMIKVSKHFQCWEHVDGSL-VNVAEG---LELYANVLNTYE 222
+L S D TALS+ E A P + C GSL ++ +EG Y +V
Sbjct: 794 QLVSGDSTALSQSEDGARAPFTQAEMCLPCCSPQQGSLQLSSSEGGASTMAYMHVAEVVS 853

Query: 221 ASQVASLITELQSSGR 174
A+ + LQ SGR
Sbjct: 854 AASAQGTLGMLQQSGR 869


>sp|Q5R5R2|HEAT6_PONAB HEAT repeat-containing protein 6 OS=Pongo
abelii GN=HEATR6 PE=2 SV=1
Length = 1181

Score = 31.2 bits (69), Expect = 2.6
Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
Frame = +2

Query: 128 HSFLNYECLSTKVLLAFLKTAIPL*EKQLVKPHMCSAHLRKVPTLQPHL--PNFHRHAPS 301
H +N S +L A + T PL E QL+ CS+ L + PHL P++ + AP+
Sbjct: 573 HKDVNVRVSSLTLLGAIVSTHAPLPEVQLLLQQPCSSGLSNSNSATPHLSPPDWWKKAPA 632


>sp|Q6AI08|HEAT6_HUMAN HEAT repeat-containing protein 6 OS=Homo
sapiens GN=HEATR6 PE=1 SV=1
Length = 1181

Score = 30.8 bits (68), Expect = 3.4
Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
Frame = +2

Query: 128 HSFLNYECLSTKVLLAFLKTAIPL*EKQLVKPHMCSAHLRKVPTLQPHL--PNFHRHAPS 301
H +N S +L A + T PL E QL+ CS+ L + PHL P++ + AP+
Sbjct: 573 HKDVNVRVSSLTLLGAIVSTHAPLPEVQLLLQQPCSSGLGNSNSATPHLSPPDWWKKAPA 632


>sp|A2A891|CMTA1_MOUSE Calmodulin-binding transcription activator 1
OS=Mus musculus GN=Camta1 PE=2 SV=1
Length = 1682

Score = 30.8 bits (68), Expect = 3.4
Identities = 24/76 (31%), Positives = 32/76 (42%), Gaps = 4/76 (5%)
Frame = -1

Query: 389 KLFSTDFTALSKEEQDAHLPMIKVSKHFQCWEHVDGSL-VNVAEG---LELYANVLNTYE 222
+L S D ALS+ E A P + C GSL ++ AEG Y +V
Sbjct: 796 QLVSGDSAALSQSEDGARAPFTQAEMCIPCCSPQQGSLQLSSAEGGPSTMAYMHVAEVVS 855

Query: 221 ASQVASLITELQSSGR 174
A+ + LQ SGR
Sbjct: 856 AASAQGALGMLQQSGR 871


>sp|P05990|PYR1_DROME CAD protein OS=Drosophila melanogaster GN=r
PE=1 SV=3
Length = 2224

Score = 29.6 bits (65), Expect = 7.5
Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 4/49 (8%)
Frame = +1

Query: 73 LLSLCCYLQ----TELLPWNSRSFFSQLRMSFHQSSPRLPEDCNSVIRE 207
L L C LQ LLPW++R Q F + P PE C+ ++++
Sbjct: 205 LNQLRCLLQRGASVTLLPWSARLEDEQFDALFLSNGPGNPESCDQIVQQ 253


>sp|Q67825|POLG_HAVGB Genome polyprotein OS=Human hepatitis A virus
genotype IA (isolate GBM) PE=3 SV=1
Length = 2227

Score = 29.6 bits (65), Expect = 7.5
Identities = 17/57 (29%), Positives = 28/57 (49%)
Frame = +2

Query: 23 QTIDKRIENQRHRI*QFS*AFVVISKLNYFLGTPVHSFLNYECLSTKVLLAFLKTAI 193
Q IDK+IE+QR +FS + + F +P+H ++ ++ L F K I
Sbjct: 1729 QNIDKKIESQRIMKVEFSQCSMNVVSKTLFRKSPIHHHIDKTMINFPAALPFSKAEI 1785


>sp|Q4U3U9|CAPSD_TNAVC Major capsid protein OS=Trichoplusia ni
ascovirus 2c GN=MCP-1 PE=1 SV=2
Length = 480

Score = 29.3 bits (64), Expect = 9.8
Identities = 13/32 (40%), Positives = 19/32 (59%)
Frame = -2

Query: 136 KRMNGSSKEVIQFGDNNKGSGELLDPMPLVFN 41
K M G SKE+ D G+G ++ P+PL F+
Sbjct: 172 KEMIGGSKELWDLDDKVAGAGTIILPLPLFFS 203


tr_hit_id Q5RJC7
Definition tr|Q5RJC7|Q5RJC7_ARATH At4g36090 OS=Arabidopsis thaliana
Align length 68
Score (bit) 58.5
E-value 4.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916752|Adiantum capillus-veneris mRNA, clone:
YMU001_000091_B10.
(482 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5RJC7|Q5RJC7_ARATH At4g36090 OS=Arabidopsis thaliana PE=2 SV=1 59 4e-12
tr|Q67Y44|Q67Y44_ARATH Putative uncharacterized protein At4g3609... 59 4e-12
tr|Q2V3B6|Q2V3B6_ARATH Uncharacterized protein At4g36090.1 OS=Ar... 59 4e-12
tr|Q9SL49|Q9SL49_ARATH Putative uncharacterized protein At2g1797... 54 3e-11
tr|A8MRW3|A8MRW3_ARATH Uncharacterized protein At2g17970.2 OS=Ar... 54 3e-11
tr|A5B5L4|A5B5L4_VITVI Putative uncharacterized protein OS=Vitis... 50 2e-10
tr|A7QDZ0|A7QDZ0_VITVI Chromosome chr4 scaffold_83, whole genome... 50 2e-10
tr|Q5VPG7|Q5VPG7_ORYSJ Os06g0138200 protein OS=Oryza sativa subs... 48 6e-10
tr|B8B2A9|B8B2A9_ORYSI Putative uncharacterized protein OS=Oryza... 48 6e-10
tr|Q5XVJ1|Q5XVJ1_ARATH Putative uncharacterized protein OS=Arabi... 50 3e-09
tr|Q5XVJ2|Q5XVJ2_ARATH Putative uncharacterized protein OS=Arabi... 50 3e-09
tr|Q9M9A0|Q9M9A0_ARATH F27J15.23 OS=Arabidopsis thaliana GN=At1g... 50 3e-09
tr|Q9FVQ3|Q9FVQ3_ARATH Putative uncharacterized protein F27K7.16... 50 3e-09
tr|A1YKE1|A1YKE1_BRASY Oxidoreductase OS=Brachypodium sylvaticum... 50 4e-09
tr|Q9ZT92|Q9ZT92_ARATH Putative uncharacterized protein AT4g0294... 48 1e-08
tr|B8LLT0|B8LLT0_PICSI Putative uncharacterized protein OS=Picea... 47 2e-08
tr|A3B3V5|A3B3V5_ORYSJ Putative uncharacterized protein OS=Oryza... 40 6e-08
tr|B8AY32|B8AY32_ORYSI Putative uncharacterized protein OS=Oryza... 40 7e-08
tr|B6ST02|B6ST02_MAIZE Oxidoreductase, 2OG-Fe oxygenase family p... 40 8e-08
tr|O65646|O65646_ARATH Putative uncharacterized protein T19K4.22... 59 2e-07
tr|A7PU45|A7PU45_VITVI Chromosome chr7 scaffold_31, whole genome... 39 1e-06
tr|Q9LQV9|Q9LQV9_ARATH F10B6.11 OS=Arabidopsis thaliana PE=4 SV=1 55 2e-06
tr|A9PG91|A9PG91_POPTR Putative uncharacterized protein OS=Popul... 55 2e-06
tr|B8AY31|B8AY31_ORYSI Putative uncharacterized protein OS=Oryza... 40 2e-06
tr|B3H7C3|B3H7C3_ARATH Uncharacterized protein At1g48980.4 OS=Ar... 50 4e-05
tr|B7ZX44|B7ZX44_MAIZE Putative uncharacterized protein OS=Zea m... 49 9e-05
tr|Q5VPG6|Q5VPG6_ORYSJ Oxidoreductase, 2OG-Fe(II) oxygenase fami... 48 3e-04
tr|A3B878|A3B878_ORYSJ Putative uncharacterized protein OS=Oryza... 48 3e-04
tr|Q676Z3|Q676Z3_HYAOR Putative uncharacterized protein (Fragmen... 46 8e-04
tr|Q6ATY1|Q6ATY1_ORYSJ Os05g0401500 protein OS=Oryza sativa subs... 45 0.002

>tr|Q5RJC7|Q5RJC7_ARATH At4g36090 OS=Arabidopsis thaliana PE=2 SV=1
Length = 520

Score = 58.5 bits (140), Expect(2) = 4e-12
Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 1/68 (1%)
Frame = -1

Query: 362 LSKEEQDAHLPM-IKVSKHFQCWEHVDGSLVNVAEGLELYANVLNTYEASQVASLITELQ 186
LS+EE++ + M +K K F C+E V G VN+ EGLEL+ V + E ++ + ELQ
Sbjct: 184 LSREERERYRFMNVKKMKVFSCYEKVRGRSVNILEGLELHTGVFSAVEQKKIVDFVYELQ 243

Query: 185 SSGRRGEL 162
GRRGEL
Sbjct: 244 EKGRRGEL 251



Score = 35.4 bits (80), Expect(2) = 4e-12
Identities = 16/41 (39%), Positives = 24/41 (58%)
Frame = -2

Query: 124 GSSKEVIQFGDNNKGSGELLDPMPLVFNSLIDRLILWHILP 2
G+ ++Q GD +DPMP +F +I RL+ WH+LP
Sbjct: 285 GNPPGILQRGD--------VDPMPSIFKVIIKRLVGWHVLP 317


>tr|Q67Y44|Q67Y44_ARATH Putative uncharacterized protein At4g36090
OS=Arabidopsis thaliana GN=At4g36090 PE=2 SV=1
Length = 452

Score = 58.5 bits (140), Expect(2) = 4e-12
Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 1/68 (1%)
Frame = -1

Query: 362 LSKEEQDAHLPM-IKVSKHFQCWEHVDGSLVNVAEGLELYANVLNTYEASQVASLITELQ 186
LS+EE++ + M +K K F C+E V G VN+ EGLEL+ V + E ++ + ELQ
Sbjct: 116 LSREERERYRFMNVKKMKVFSCYEKVRGRSVNILEGLELHTGVFSAVEQKKIVDFVYELQ 175

Query: 185 SSGRRGEL 162
GRRGEL
Sbjct: 176 EKGRRGEL 183



Score = 35.4 bits (80), Expect(2) = 4e-12
Identities = 16/41 (39%), Positives = 24/41 (58%)
Frame = -2

Query: 124 GSSKEVIQFGDNNKGSGELLDPMPLVFNSLIDRLILWHILP 2
G+ ++Q GD +DPMP +F +I RL+ WH+LP
Sbjct: 217 GNPPGILQRGD--------VDPMPSIFKVIIKRLVGWHVLP 249


>tr|Q2V3B6|Q2V3B6_ARATH Uncharacterized protein At4g36090.1
OS=Arabidopsis thaliana GN=At4g36090 PE=4 SV=1
Length = 385

Score = 58.5 bits (140), Expect(2) = 4e-12
Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 1/68 (1%)
Frame = -1

Query: 362 LSKEEQDAHLPM-IKVSKHFQCWEHVDGSLVNVAEGLELYANVLNTYEASQVASLITELQ 186
LS+EE++ + M +K K F C+E V G VN+ EGLEL+ V + E ++ + ELQ
Sbjct: 184 LSREERERYRFMNVKKMKVFSCYEKVRGRSVNILEGLELHTGVFSAVEQKKIVDFVYELQ 243

Query: 185 SSGRRGEL 162
GRRGEL
Sbjct: 244 EKGRRGEL 251



Score = 35.4 bits (80), Expect(2) = 4e-12
Identities = 16/41 (39%), Positives = 24/41 (58%)
Frame = -2

Query: 124 GSSKEVIQFGDNNKGSGELLDPMPLVFNSLIDRLILWHILP 2
G+ ++Q GD +DPMP +F +I RL+ WH+LP
Sbjct: 285 GNPPGILQRGD--------VDPMPSIFKVIIKRLVGWHVLP 317


>tr|Q9SL49|Q9SL49_ARATH Putative uncharacterized protein At2g17970
(At2g17970) OS=Arabidopsis thaliana GN=At2g17970 PE=2
SV=1
Length = 507

Score = 53.5 bits (127), Expect(2) = 3e-11
Identities = 25/64 (39%), Positives = 37/64 (57%)
Frame = -1

Query: 353 EEQDAHLPMIKVSKHFQCWEHVDGSLVNVAEGLELYANVLNTYEASQVASLITELQSSGR 174
+ ++ L +K K F C E V G +VNV +GLEL+ V + E ++ + +LQ GR
Sbjct: 184 QRENLRLINVKRKKDFICLERVKGKIVNVLDGLELHTGVFSAVEQKRIVDQVYQLQEKGR 243

Query: 173 RGEL 162
RGEL
Sbjct: 244 RGEL 247



Score = 37.7 bits (86), Expect(2) = 3e-11
Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 13/64 (20%)
Frame = -2

Query: 154 KTFVV-EKRMNGSSKEVIQFG----------DNNKG--SGELLDPMPLVFNSLIDRLILW 14
+TF K M G +E IQFG N G E +DP+P +F +I +LI W
Sbjct: 250 RTFTAPHKWMRGKGRETIQFGCCYNYAPDRAGNPPGILQREEVDPLPHLFKVIIRKLIKW 309

Query: 13 HILP 2
H+LP
Sbjct: 310 HVLP 313


>tr|A8MRW3|A8MRW3_ARATH Uncharacterized protein At2g17970.2
OS=Arabidopsis thaliana GN=At2g17970 PE=4 SV=1
Length = 433

Score = 53.5 bits (127), Expect(2) = 3e-11
Identities = 25/64 (39%), Positives = 37/64 (57%)
Frame = -1

Query: 353 EEQDAHLPMIKVSKHFQCWEHVDGSLVNVAEGLELYANVLNTYEASQVASLITELQSSGR 174
+ ++ L +K K F C E V G +VNV +GLEL+ V + E ++ + +LQ GR
Sbjct: 110 QRENLRLINVKRKKDFICLERVKGKIVNVLDGLELHTGVFSAVEQKRIVDQVYQLQEKGR 169

Query: 173 RGEL 162
RGEL
Sbjct: 170 RGEL 173



Score = 37.7 bits (86), Expect(2) = 3e-11
Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 13/64 (20%)
Frame = -2

Query: 154 KTFVV-EKRMNGSSKEVIQFG----------DNNKG--SGELLDPMPLVFNSLIDRLILW 14
+TF K M G +E IQFG N G E +DP+P +F +I +LI W
Sbjct: 176 RTFTAPHKWMRGKGRETIQFGCCYNYAPDRAGNPPGILQREEVDPLPHLFKVIIRKLIKW 235

Query: 13 HILP 2
H+LP
Sbjct: 236 HVLP 239


>tr|A5B5L4|A5B5L4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_020466 PE=4 SV=1
Length = 849

Score = 49.7 bits (117), Expect(2) = 2e-10
Identities = 28/83 (33%), Positives = 40/83 (48%), Gaps = 10/83 (12%)
Frame = -1

Query: 380 STDFTALSKEEQDAHLPM----------IKVSKHFQCWEHVDGSLVNVAEGLELYANVLN 231
ST +SK + A LP ++ K F C E V G VN+ +GLEL+ + +
Sbjct: 514 STGEVGVSKVPRKAELPREQREYIRFRNVQRKKDFICLERVKGKFVNILDGLELHVGIFS 573

Query: 230 TYEASQVASLITELQSSGRRGEL 162
E ++ I ELQ GR G+L
Sbjct: 574 AAEQKRIVDFIYELQEMGRNGQL 596



Score = 38.9 bits (89), Expect(2) = 2e-10
Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 12/58 (20%)
Frame = -2

Query: 139 EKRMNGSSKEVIQFG-------DNNKG-----SGELLDPMPLVFNSLIDRLILWHILP 2
+K M G + IQFG D N E++DP+P +F +I RL+ WH+LP
Sbjct: 605 QKWMRGKGRVTIQFGCCYNYATDKNGNPPGILQNEVVDPIPPLFKVIIRRLVRWHVLP 662


>tr|A7QDZ0|A7QDZ0_VITVI Chromosome chr4 scaffold_83, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00036792001
PE=4 SV=1
Length = 510

Score = 49.7 bits (117), Expect(2) = 2e-10
Identities = 28/83 (33%), Positives = 40/83 (48%), Gaps = 10/83 (12%)
Frame = -1

Query: 380 STDFTALSKEEQDAHLPM----------IKVSKHFQCWEHVDGSLVNVAEGLELYANVLN 231
ST +SK + A LP ++ K F C E V G VN+ +GLEL+ + +
Sbjct: 175 STGEVGVSKVPRKAELPREQREYIRFRNVQRKKDFICLERVKGKFVNILDGLELHVGIFS 234

Query: 230 TYEASQVASLITELQSSGRRGEL 162
E ++ I ELQ GR G+L
Sbjct: 235 AAEQKRIVDFIYELQEMGRNGQL 257



Score = 38.9 bits (89), Expect(2) = 2e-10
Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 12/58 (20%)
Frame = -2

Query: 139 EKRMNGSSKEVIQFG-------DNNKG-----SGELLDPMPLVFNSLIDRLILWHILP 2
+K M G + IQFG D N E++DP+P +F +I RL+ WH+LP
Sbjct: 266 QKWMRGKGRVTIQFGCCYNYATDKNGNPPGILQNEVVDPIPPLFKVIIRRLVRWHVLP 323


>tr|Q5VPG7|Q5VPG7_ORYSJ Os06g0138200 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0041F13.13-1 PE=4 SV=1
Length = 616

Score = 47.8 bits (112), Expect(2) = 6e-10
Identities = 21/51 (41%), Positives = 31/51 (60%)
Frame = -1

Query: 314 KHFQCWEHVDGSLVNVAEGLELYANVLNTYEASQVASLITELQSSGRRGEL 162
K F C+E V+G LVN+ GLEL+ V + E ++ + +LQ G+ GEL
Sbjct: 186 KDFICFERVNGRLVNILAGLELHCGVFSAAEQKRIVDYVYDLQEMGKHGEL 236



Score = 38.9 bits (89), Expect(2) = 6e-10
Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 13/66 (19%)
Frame = -2

Query: 160 GGKTFVVEKR-MNGSSKEVIQFG-------DNNKGSGELL-----DPMPLVFNSLIDRLI 20
G +T+ +R M G + IQFG D N ++ DPMP +F +I RL+
Sbjct: 237 GDRTYTEPQRWMRGKGRVTIQFGCCYNYATDKNGNPPGIIRTIASDPMPSLFKIMIKRLV 296

Query: 19 LWHILP 2
WH+LP
Sbjct: 297 RWHVLP 302


>tr|B8B2A9|B8B2A9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_21553 PE=4 SV=1
Length = 600

Score = 47.8 bits (112), Expect(2) = 6e-10
Identities = 21/51 (41%), Positives = 31/51 (60%)
Frame = -1

Query: 314 KHFQCWEHVDGSLVNVAEGLELYANVLNTYEASQVASLITELQSSGRRGEL 162
K F C+E V+G LVN+ GLEL+ V + E ++ + +LQ G+ GEL
Sbjct: 171 KDFICFERVNGRLVNILAGLELHCGVFSAAEQKRIVDYVYDLQEMGKHGEL 221



Score = 38.9 bits (89), Expect(2) = 6e-10
Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 13/66 (19%)
Frame = -2

Query: 160 GGKTFVVEKR-MNGSSKEVIQFG-------DNNKGSGELL-----DPMPLVFNSLIDRLI 20
G +T+ +R M G + IQFG D N ++ DPMP +F +I RL+
Sbjct: 222 GDRTYTEPQRWMRGKGRVTIQFGCCYNYATDKNGNPPGIIRTIASDPMPSLFKIMIKRLV 281

Query: 19 LWHILP 2
WH+LP
Sbjct: 282 RWHVLP 287


>tr|Q5XVJ1|Q5XVJ1_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana GN=At1g48980 PE=2 SV=1
Length = 331

Score = 50.4 bits (119), Expect(2) = 3e-09
Identities = 26/65 (40%), Positives = 37/65 (56%), Gaps = 2/65 (3%)
Frame = -1

Query: 350 EQDAHLPMIKVSKH--FQCWEHVDGSLVNVAEGLELYANVLNTYEASQVASLITELQSSG 177
+Q H+ I V + F C E V+G LVN+ EGLEL+ V N E ++ + ELQ
Sbjct: 71 KQRTHIRAINVKRKRDFVCLEKVNGELVNILEGLELHTEVFNAAEQRRIVDKVCELQEKV 130

Query: 176 RRGEL 162
++GEL
Sbjct: 131 QKGEL 135



Score = 33.9 bits (76), Expect(2) = 3e-09
Identities = 12/24 (50%), Positives = 18/24 (75%)
Frame = -2

Query: 73 ELLDPMPLVFNSLIDRLILWHILP 2
E +DP+P +F +I RL+ WH+LP
Sbjct: 172 ETVDPLPHLFKVIIRRLVKWHVLP 195