BP916770
Clone id YMU001_000091_D06
Library
Length 509
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000091_D06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTGGCTTCATTCAAATCCAGCTCATCTTGTGCTCCCAAAACCAAATGCAATAAGTTGTTA
ACCTCACTGCCAGCCTTGAAATCTCTCGTCTTGGAAACTTCAAGAGACTGCTCTTGATGG
CCGATGGCGGAAGTGGCTCTTGTTACATCAGAGAAATGACAATTGTCTGAAGACAAAGAA
GAGGTGGAGGAGCTTTCAGTGGCCACAGTAGCATTTTCACCCTCCTCACTCATACTAATA
GATGTTGATTCCACAGGAGACACTAAGGACTCTTCAGAAAATCCCTCTGCAGCCTCAAAT
CCTTTCAAGTAATCAACATCAGTAGTAGGTGTTTCTTTGCCTTTCCACATTAAGATTTGC
TCATCATTGAAAGAAAGTAGAACGCAGGGGACGAGATCTTTTAATTTTGCCCCAAGCTTC
TTGTAGTCGCTCGGATTAAGTCCGGTACAGTCGATTCGCACTATTTCGTCCAGTTTAAAA
GCAGCCCTCACATCCTCGACAAGATTAAT
■■Homology search results ■■ -
sp_hit_id Q9LDA9
Definition sp|Q9LDA9|CAF2P_ARATH CRS2-associated factor 2, chloroplastic OS=Arabidopsis thaliana
Align length 66
Score (bit) 98.6
E-value 2.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916770|Adiantum capillus-veneris mRNA, clone:
YMU001_000091_D06.
(509 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LDA9|CAF2P_ARATH CRS2-associated factor 2, chloroplastic OS... 99 2e-20
sp|Q84N48|CAF2P_MAIZE CRS2-associated factor 2, chloroplastic OS... 94 4e-19
sp|Q657G7|CAF2P_ORYSJ CRS2-associated factor 2, chloroplastic OS... 92 1e-18
sp|Q9SL79|CAF1P_ARATH CRS2-associated factor 1, chloroplastic OS... 89 9e-18
sp|Q5VMQ5|CAF1P_ORYSJ CRS2-associated factor 1, chloroplastic OS... 83 7e-16
sp|Q84N49|CAF1P_MAIZE CRS2-associated factor 1, chloroplastic OS... 83 7e-16
sp|Q8VYD9|CAF1M_ARATH CRS2-associated factor 1, mitochondrial OS... 81 3e-15
sp|Q6Z4U2|CAF1M_ORYSJ CRS2-associated factor 1, mitochondrial OS... 78 2e-14
sp|Q0J7J7|CAF2M_ORYSJ CRS2-associated factor 2, mitochondrial OS... 78 3e-14
sp|Q9FFU1|CAF2M_ARATH CRS2-associated factor 2, mitochondrial OS... 75 2e-13
sp|Q1MPR2|RL4_LAWIP 50S ribosomal protein L4 OS=Lawsonia intrace... 34 0.35
sp|Q8MX88|CRM_DROSE Protein cramped OS=Drosophila sechellia GN=c... 33 0.59
sp|Q48SS4|SYA_STRPM Alanyl-tRNA synthetase OS=Streptococcus pyog... 32 2.3
sp|A2RDY3|SYA_STRPG Alanyl-tRNA synthetase OS=Streptococcus pyog... 32 2.3
sp|Q1J5Z4|SYA_STRPF Alanyl-tRNA synthetase OS=Streptococcus pyog... 32 2.3
sp|Q1JG77|SYA_STRPD Alanyl-tRNA synthetase OS=Streptococcus pyog... 32 2.3
sp|Q1JL53|SYA_STRPC Alanyl-tRNA synthetase OS=Streptococcus pyog... 32 2.3
sp|Q1JB08|SYA_STRPB Alanyl-tRNA synthetase OS=Streptococcus pyog... 32 2.3
sp|Q8P0E6|SYA_STRP8 Alanyl-tRNA synthetase OS=Streptococcus pyog... 32 2.3
sp|Q5XBH1|SYA_STRP6 Alanyl-tRNA synthetase OS=Streptococcus pyog... 32 2.3
sp|Q878X3|SYA_STRP3 Alanyl-tRNA synthetase OS=Streptococcus pyog... 32 2.3
sp|Q99Z57|SYA_STRP1 Alanyl-tRNA synthetase OS=Streptococcus pyog... 32 2.3
sp|A8AYI8|SYA_STRGC Alanyl-tRNA synthetase OS=Streptococcus gord... 32 2.3
sp|Q8E0C4|SYA_STRA5 Alanyl-tRNA synthetase OS=Streptococcus agal... 32 2.3
sp|Q8E600|SYA_STRA3 Alanyl-tRNA synthetase OS=Streptococcus agal... 32 2.3
sp|Q3K1P7|SYA_STRA1 Alanyl-tRNA synthetase OS=Streptococcus agal... 32 2.3
sp|A7I1W6|HIS4_CAMHC 1-(5-phosphoribosyl)-5-[(5-phosphoribosylam... 31 2.9
sp|O64747|WRK35_ARATH Probable WRKY transcription factor 35 OS=A... 31 3.9
sp|A5DI74|U507_PICGU UPF0507 protein PGUG_02975 OS=Pichia guilli... 30 5.0
sp|A3CLY3|SYA_STRSV Alanyl-tRNA synthetase OS=Streptococcus sang... 30 6.6

>sp|Q9LDA9|CAF2P_ARATH CRS2-associated factor 2, chloroplastic
OS=Arabidopsis thaliana GN=At1g23400 PE=2 SV=1
Length = 564

Score = 98.6 bits (244), Expect = 2e-20
Identities = 44/66 (66%), Positives = 57/66 (86%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKET 330
++LV+DVR AF+L +V++DC GL PSDYKK+GAKLK+LVPCVLLSF+DEQILMW+G+E
Sbjct: 349 VSLVKDVRDAFELSSLVKVDCPGLEPSDYKKIGAKLKELVPCVLLSFDDEQILMWRGREW 408

Query: 329 PTTDVD 312
+ VD
Sbjct: 409 KSRFVD 414


>sp|Q84N48|CAF2P_MAIZE CRS2-associated factor 2, chloroplastic
OS=Zea mays GN=CAF2 PE=1 SV=1
Length = 611

Score = 94.0 bits (232), Expect = 4e-19
Identities = 44/59 (74%), Positives = 53/59 (89%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKE 333
I LV+DVR AF+ ++V+IDC GLNPSDYKK+GAKL+DLVPCVLLSF+DEQILM +GKE
Sbjct: 380 ITLVKDVRDAFEGSDLVKIDCEGLNPSDYKKIGAKLRDLVPCVLLSFDDEQILMHRGKE 438


>sp|Q657G7|CAF2P_ORYSJ CRS2-associated factor 2, chloroplastic
OS=Oryza sativa subsp. japonica GN=Os01g0323300 PE=2
SV=1
Length = 607

Score = 92.4 bits (228), Expect = 1e-18
Identities = 50/105 (47%), Positives = 70/105 (66%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKET 330
I LV DVR AF+ ++V+IDC GLNPSDYKK+GAKL+DLVPCVLLSF++EQILM++GKE
Sbjct: 376 IYLVRDVRDAFEGSDLVKIDCEGLNPSDYKKIGAKLRDLVPCVLLSFDNEQILMFRGKEW 435

Query: 329 PTTDVDYLKGFEAAEGFSEESLVSPVESTSISMSEEGENATVATE 195
+ Y K +L+ + ++ MS + ++ AT+
Sbjct: 436 KSR---YPKPL---------TLIPKIRKNNVPMSSDESSSDEATD 468


>sp|Q9SL79|CAF1P_ARATH CRS2-associated factor 1, chloroplastic
OS=Arabidopsis thaliana GN=At2g20020 PE=1 SV=2
Length = 701

Score = 89.4 bits (220), Expect = 9e-18
Identities = 47/101 (46%), Positives = 69/101 (68%), Gaps = 8/101 (7%)
Frame = -1

Query: 506 NLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKE-- 333
+LV++V+ AF++ E+VRIDC G+ SD++K+GAKLKDLVPCVL+SF +EQIL+W+G+E
Sbjct: 390 DLVKNVKEAFEVCELVRIDCQGMKGSDFRKIGAKLKDLVPCVLVSFENEQILIWRGREWK 449

Query: 332 ----TPTTDVDYLKGFEAAEGFSE--ESLVSPVESTSISMS 228
TP D L+ E E E VSP +S +++ +
Sbjct: 450 SSLTTPDKKGDILEDIEVDTALPEDDEPSVSPNQSQTMTQN 490


>sp|Q5VMQ5|CAF1P_ORYSJ CRS2-associated factor 1, chloroplastic
OS=Oryza sativa subsp. japonica GN=Os01g0495900 PE=2
SV=1
Length = 701

Score = 83.2 bits (204), Expect = 7e-16
Identities = 37/59 (62%), Positives = 48/59 (81%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKE 333
+NLV+ VR AF+ ++VR+DC+GLN SD +K+GAKLKDLVPC LLSF E ILMW+G +
Sbjct: 331 LNLVKQVREAFEACDLVRVDCSGLNKSDCRKIGAKLKDLVPCTLLSFEFEHILMWRGND 389


>sp|Q84N49|CAF1P_MAIZE CRS2-associated factor 1, chloroplastic
OS=Zea mays GN=CAF1 PE=1 SV=1
Length = 674

Score = 83.2 bits (204), Expect = 7e-16
Identities = 37/58 (63%), Positives = 47/58 (81%)
Frame = -1

Query: 506 NLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKE 333
NLV VR AF+ ++VR+DC+GLN SD +K+GAKLKDLVPC+LLSF E ILMW+G +
Sbjct: 332 NLVNQVREAFEACDLVRVDCSGLNKSDCRKIGAKLKDLVPCILLSFEFEHILMWRGSD 389


>sp|Q8VYD9|CAF1M_ARATH CRS2-associated factor 1, mitochondrial
OS=Arabidopsis thaliana GN=At4g31010 PE=2 SV=1
Length = 405

Score = 80.9 bits (198), Expect = 3e-15
Identities = 37/68 (54%), Positives = 52/68 (76%), Gaps = 2/68 (2%)
Frame = -1

Query: 506 NLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKE-- 333
+LV VR AF + E+VRIDC GL DYKK+GAKL+DLVPC+L++F+ EQ+++W+GK+
Sbjct: 308 SLVPMVRDAFLVSELVRIDCLGLERKDYKKIGAKLRDLVPCILVTFDKEQVVIWRGKDYK 367

Query: 332 TPTTDVDY 309
P D +Y
Sbjct: 368 PPKEDDEY 375


>sp|Q6Z4U2|CAF1M_ORYSJ CRS2-associated factor 1, mitochondrial
OS=Oryza sativa subsp. japonica GN=Os08g0174900 PE=2
SV=1
Length = 428

Score = 78.2 bits (191), Expect = 2e-14
Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 14/109 (12%)
Frame = -1

Query: 506 NLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKE-- 333
+LV VR AF DE+VRID GL SDY+K+G KL+DLVPC+++SF+ EQI++W+GK+
Sbjct: 306 SLVPMVRDAFLTDELVRIDSKGLPKSDYRKIGVKLRDLVPCIIVSFDKEQIIVWRGKDYN 365

Query: 332 ------TPTTDVDYLK----GFEAAEGFSEE--SLVSPVESTSISMSEE 222
T T V L+ G E+ G E+ S + E + +S S+E
Sbjct: 366 GTIQDNTQKTSVSVLEEESAGAESENGDQEQASSDWASDECSQLSSSDE 414



Score = 34.3 bits (77), Expect = 0.35
Identities = 14/57 (24%), Positives = 34/57 (59%)
Frame = -1

Query: 506 NLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGK 336
N++ D+ +K DE VR+ C G+ D + + +L+D +++ + Q+++++G+
Sbjct: 188 NMLNDIHNHWKNDEAVRVKCLGVPTVDMQNVCHQLEDKTGGLIIHRHGGQLILYRGR 244


>sp|Q0J7J7|CAF2M_ORYSJ CRS2-associated factor 2, mitochondrial
OS=Oryza sativa subsp. japonica GN=Os08g0188000 PE=2
SV=2
Length = 366

Score = 77.8 bits (190), Expect = 3e-14
Identities = 34/58 (58%), Positives = 46/58 (79%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGK 336
+N+V+ VR AFK E+VR+DC+ + SD KK+G KL+DLVPCV L F DEQI++W+GK
Sbjct: 293 VNVVDRVREAFKTVEVVRLDCSHVGSSDCKKIGVKLRDLVPCVPLLFKDEQIILWRGK 350


>sp|Q9FFU1|CAF2M_ARATH CRS2-associated factor 2, mitochondrial
OS=Arabidopsis thaliana GN=At5g54890 PE=2 SV=1
Length = 358

Score = 75.1 bits (183), Expect = 2e-13
Identities = 32/60 (53%), Positives = 46/60 (76%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKET 330
+N+V VR F+ +EIVR+DCT + SD K++G KLK++VPCV + F DEQI++W+GK T
Sbjct: 291 VNVVGRVREEFETEEIVRLDCTHVGMSDCKRIGVKLKEMVPCVPILFKDEQIILWRGKRT 350


tr_hit_id B4FL04
Definition tr|B4FL04|B4FL04_MAIZE Putative uncharacterized protein OS=Zea mays
Align length 59
Score (bit) 94.0
E-value 4.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916770|Adiantum capillus-veneris mRNA, clone:
YMU001_000091_D06.
(509 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4FL04|B4FL04_MAIZE Putative uncharacterized protein OS=Zea m... 94 4e-18
tr|A2ZSI0|A2ZSI0_ORYSJ Putative uncharacterized protein OS=Oryza... 92 1e-17
tr|A2WP81|A2WP81_ORYSI Putative uncharacterized protein OS=Oryza... 92 1e-17
tr|A7PEJ5|A7PEJ5_VITVI Chromosome chr11 scaffold_13, whole genom... 88 3e-16
tr|A7QNZ5|A7QNZ5_VITVI Chromosome chr1 scaffold_135, whole genom... 86 1e-15
tr|A9T8N2|A9T8N2_PHYPA Predicted protein (Fragment) OS=Physcomit... 84 5e-15
tr|A7R839|A7R839_VITVI Chromosome undetermined scaffold_2239, wh... 84 5e-15
tr|B8A8K9|B8A8K9_ORYSI Putative uncharacterized protein OS=Oryza... 83 7e-15
tr|B7EAM6|B7EAM6_ORYSJ cDNA clone:J013002G18, full insert sequen... 83 7e-15
tr|B4F8Y9|B4F8Y9_MAIZE Putative uncharacterized protein OS=Zea m... 83 7e-15
tr|A2ZTI0|A2ZTI0_ORYSJ Putative uncharacterized protein OS=Oryza... 83 7e-15
tr|B4FMT1|B4FMT1_MAIZE Putative uncharacterized protein OS=Zea m... 82 1e-14
tr|A7P0S4|A7P0S4_VITVI Chromosome chr19 scaffold_4, whole genome... 80 6e-14
tr|A7PY62|A7PY62_VITVI Chromosome chr15 scaffold_37, whole genom... 79 2e-13
tr|A3BQ50|A3BQ50_ORYSJ Putative uncharacterized protein OS=Oryza... 78 2e-13
tr|A2YRR0|A2YRR0_ORYSI Putative uncharacterized protein OS=Oryza... 78 2e-13
tr|B8BBE8|B8BBE8_ORYSI Putative uncharacterized protein OS=Oryza... 78 3e-13
tr|A3BQB0|A3BQB0_ORYSJ Putative uncharacterized protein OS=Oryza... 78 3e-13
tr|B6SWV8|B6SWV8_MAIZE CRS2-associated factor 1 OS=Zea mays PE=2... 77 4e-13
tr|A9S0V5|A9S0V5_PHYPA Predicted protein (Fragment) OS=Physcomit... 72 2e-11
tr|A5B5A7|A5B5A7_VITVI Putative uncharacterized protein OS=Vitis... 51 3e-05
tr|Q7ZX44|Q7ZX44_XENLA Txndc5-prov protein OS=Xenopus laevis GN=... 37 0.72
tr|B1AWV2|B1AWV2_MOUSE Palm2-Akap2 fusion protein (Fragment) OS=... 34 4.7
tr|A2APJ0|A2APJ0_MOUSE Palm2-Akap2 fusion protein (Fragment) OS=... 34 4.7
tr|B4I9Z9|B4I9Z9_DROSE Crm OS=Drosophila sechellia GN=Dsec\crm P... 33 6.1
tr|Q75BP4|Q75BP4_ASHGO ACR227Wp OS=Ashbya gossypii GN=ACR227W PE... 33 6.1
tr|Q5Z7H5|Q5Z7H5_ORYSJ Os06g0557100 protein OS=Oryza sativa subs... 33 8.0
tr|A9S7Z4|A9S7Z4_PHYPA Predicted protein OS=Physcomitrella paten... 33 8.0
tr|A2YE19|A2YE19_ORYSI Putative uncharacterized protein OS=Oryza... 33 8.0

>tr|B4FL04|B4FL04_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 611

Score = 94.0 bits (232), Expect = 4e-18
Identities = 44/59 (74%), Positives = 53/59 (89%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKE 333
I LV+DVR AF+ ++V+IDC GLNPSDYKK+GAKL+DLVPCVLLSF+DEQILM +GKE
Sbjct: 380 ITLVKDVRDAFEGSDLVKIDCEGLNPSDYKKIGAKLRDLVPCVLLSFDDEQILMHRGKE 438


>tr|A2ZSI0|A2ZSI0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_001502 PE=4 SV=1
Length = 509

Score = 92.4 bits (228), Expect = 1e-17
Identities = 50/105 (47%), Positives = 70/105 (66%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKET 330
I LV DVR AF+ ++V+IDC GLNPSDYKK+GAKL+DLVPCVLLSF++EQILM++GKE
Sbjct: 278 IYLVRDVRDAFEGSDLVKIDCEGLNPSDYKKIGAKLRDLVPCVLLSFDNEQILMFRGKEW 337

Query: 329 PTTDVDYLKGFEAAEGFSEESLVSPVESTSISMSEEGENATVATE 195
+ Y K +L+ + ++ MS + ++ AT+
Sbjct: 338 KSR---YPKPL---------TLIPKIRKNNVPMSSDESSSDEATD 370


>tr|A2WP81|A2WP81_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_01650 PE=4 SV=1
Length = 609

Score = 92.4 bits (228), Expect = 1e-17
Identities = 50/105 (47%), Positives = 70/105 (66%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKET 330
I LV DVR AF+ ++V+IDC GLNPSDYKK+GAKL+DLVPCVLLSF++EQILM++GKE
Sbjct: 378 IYLVRDVRDAFEGSDLVKIDCEGLNPSDYKKIGAKLRDLVPCVLLSFDNEQILMFRGKEW 437

Query: 329 PTTDVDYLKGFEAAEGFSEESLVSPVESTSISMSEEGENATVATE 195
+ Y K +L+ + ++ MS + ++ AT+
Sbjct: 438 KSR---YPKPL---------TLIPKIRKNNVPMSSDESSSDEATD 470


>tr|A7PEJ5|A7PEJ5_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016688001
PE=4 SV=1
Length = 752

Score = 87.8 bits (216), Expect = 3e-16
Identities = 48/96 (50%), Positives = 62/96 (64%), Gaps = 3/96 (3%)
Frame = -1

Query: 506 NLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKG---K 336
+LV +VR AF+ E+VRI+C GLN SDY+K+GAKLKDLVPCVL+SF E ILMW+G K
Sbjct: 391 DLVNNVREAFEECELVRINCQGLNASDYRKIGAKLKDLVPCVLISFEHEHILMWRGSDWK 450

Query: 335 ETPTTDVDYLKGFEAAEGFSEESLVSPVESTSISMS 228
D K + ++ SE S+ P E +S S
Sbjct: 451 FLHPKPEDGCKEAKESDNNSEASIPPPFEGQELSAS 486


>tr|A7QNZ5|A7QNZ5_VITVI Chromosome chr1 scaffold_135, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00002735001
PE=4 SV=1
Length = 561

Score = 85.9 bits (211), Expect = 1e-15
Identities = 39/57 (68%), Positives = 50/57 (87%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKG 339
I+LV+DVR AF+ +V+IDC G++ SDYKK+GAKLK+LVPCVLLSF+DEQIL W+G
Sbjct: 342 ISLVKDVRDAFEGSPLVKIDCKGMHASDYKKIGAKLKELVPCVLLSFDDEQILTWRG 398


>tr|A9T8N2|A9T8N2_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_2185 PE=4 SV=1
Length = 295

Score = 83.6 bits (205), Expect = 5e-15
Identities = 38/59 (64%), Positives = 47/59 (79%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKE 333
+NLV DVR AF+ D +V++DC +N D +K+GAKLKDLVPCVLLSF+ E ILMWKG E
Sbjct: 237 LNLVRDVRNAFQADNLVKVDCEKMNTHDLRKIGAKLKDLVPCVLLSFDHECILMWKGPE 295


>tr|A7R839|A7R839_VITVI Chromosome undetermined scaffold_2239, whole
genome shotgun sequence (Fragment) OS=Vitis vinifera
GN=GSVIVT00011160001 PE=4 SV=1
Length = 469

Score = 83.6 bits (205), Expect = 5e-15
Identities = 38/57 (66%), Positives = 49/57 (85%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKG 339
I+LV+DVR AF+ +V+IDC G++ SDYKK+GAKLK+ VPCVLLSF+DEQIL W+G
Sbjct: 308 ISLVKDVRDAFEGSPLVKIDCKGMHASDYKKIGAKLKESVPCVLLSFDDEQILTWRG 364


>tr|B8A8K9|B8A8K9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_02075 PE=4 SV=1
Length = 701

Score = 83.2 bits (204), Expect = 7e-15
Identities = 37/59 (62%), Positives = 48/59 (81%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKE 333
+NLV+ VR AF+ ++VR+DC+GLN SD +K+GAKLKDLVPC LLSF E ILMW+G +
Sbjct: 331 LNLVKQVREAFEACDLVRVDCSGLNKSDCRKIGAKLKDLVPCTLLSFEFEHILMWRGND 389


>tr|B7EAM6|B7EAM6_ORYSJ cDNA clone:J013002G18, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 701

Score = 83.2 bits (204), Expect = 7e-15
Identities = 37/59 (62%), Positives = 48/59 (81%)
Frame = -1

Query: 509 INLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKE 333
+NLV+ VR AF+ ++VR+DC+GLN SD +K+GAKLKDLVPC LLSF E ILMW+G +
Sbjct: 331 LNLVKQVREAFEACDLVRVDCSGLNKSDCRKIGAKLKDLVPCTLLSFEFEHILMWRGND 389


>tr|B4F8Y9|B4F8Y9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 560

Score = 83.2 bits (204), Expect = 7e-15
Identities = 37/58 (63%), Positives = 47/58 (81%)
Frame = -1

Query: 506 NLVEDVRAAFKLDEIVRIDCTGLNPSDYKKLGAKLKDLVPCVLLSFNDEQILMWKGKE 333
NLV VR AF+ ++VR+DC+GLN SD +K+GAKLKDLVPC+LLSF E ILMW+G +
Sbjct: 218 NLVNQVREAFEACDLVRVDCSGLNKSDCRKIGAKLKDLVPCILLSFEFEHILMWRGSD 275