BP916802
Clone id YMU001_000091_G07
Library
Length 556
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000091_G07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CGATTACATCGAAGCTATATCATCCAGAATCTCATGCCAAACACTTCTGTTGAAAAGAAA
TATCAAAGATATCTACACAAATAACTTAAACCCAACCATTTCAAAGCTATGGGATGCGAA
TTCAGATATACAATACATTTTAAATGCACACGGAGCAGCTATCTATTGTACCTCATACAT
AACAAAATTTGATAACACACTCATCAAAGCAATCAAAGAACAATTTGACTCTTGCATTGA
AAACAATGCAACTACATACGATAGACTTCGAAAAATAGGAAACACGATACTAAACACACA
GCAAATAAGCTCACAACAAGCGGTATATATTGCACTTTCCCTACCTCTCTACATCGCAAC
CCGAGAATTTATGTTCATAAACACAAACCCTCCCAACGAGAGAACAATGCTTCCCAAACG
AAAACACCTCCTACAAAACATAGACTCGACCAGCATAAAAATCTTTTACGAAACAAGCAT
AAACAAATACTGTAAACGTCCTGCCCAGCTCAATGCCGCATCATTGACAGAATTTGCCTC
GACATACAATACAACA
■■Homology search results ■■ -
sp_hit_id P52524
Definition sp|P52524|VU10_HHV7J U10 protein OS=Human herpesvirus 7 (strain JI)
Align length 77
Score (bit) 34.3
E-value 0.42
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916802|Adiantum capillus-veneris mRNA, clone:
YMU001_000091_G07.
(556 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P52524|VU10_HHV7J U10 protein OS=Human herpesvirus 7 (strain ... 34 0.42
sp|Q9NQ75|CASS4_HUMAN Cas scaffolding protein family member 4 OS... 33 1.2
sp|Q8BWQ1|UD2A3_MOUSE UDP-glucuronosyltransferase 2A3 OS=Mus mus... 32 1.6
sp|P43098|FAS2_CANAL Fatty acid synthase subunit alpha OS=Candid... 32 1.6
sp|Q6B8L1|TILS_GRATL tRNA(Ile)-lysidine synthase, chloroplastic ... 32 2.1
sp|Q6AY26|CL032_RAT Uncharacterized protein C12orf32 homolog OS=... 31 4.6
sp|Q54NP0|Y6352_DICDI Putative uncharacterized protein DDB_G0285... 30 6.1
sp|Q5FF10|RUVC_EHRRG Crossover junction endodeoxyribonuclease ru... 30 6.1
sp|O51879|MNMG_BUCAP tRNA uridine 5-carboxymethylaminomethyl mod... 30 6.1
sp|Q4IR09|RNA14_GIBZE mRNA 3'-end-processing protein RNA14 OS=Gi... 30 8.0

>sp|P52524|VU10_HHV7J U10 protein OS=Human herpesvirus 7 (strain JI)
GN=U10 PE=3 SV=1
Length = 451

Score = 34.3 bits (77), Expect = 0.42
Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 6/77 (7%)
Frame = +2

Query: 200 LIKAIKEQFDSCI---ENNATTYDRLRKIGNTILN-TQQISSQQAVY--IALSLPLYIAT 361
L+K I Q++ C + ++ L ++ I++ QQI+S+Q +Y +++LP +T
Sbjct: 40 LLKFIIHQYEQCFLPPKGTILYHNGLIELNTLIIDLNQQITSKQQIYSWTSITLPKIFST 99

Query: 362 REFMFINTNPPNERTML 412
+E FI +P +E L
Sbjct: 100 KELYFIVASPESENITL 116


>sp|Q9NQ75|CASS4_HUMAN Cas scaffolding protein family member 4
OS=Homo sapiens GN=CASS4 PE=1 SV=2
Length = 786

Score = 32.7 bits (73), Expect = 1.2
Identities = 14/33 (42%), Positives = 20/33 (60%)
Frame = +1

Query: 385 KPSQRENNASQTKTPPTKHRLDQHKNLLRNKHK 483
+P QRE + Q TP TK R D+H + L K++
Sbjct: 613 QPPQRETESHQKSTPSTKQREDEHSSELLKKNR 645


>sp|Q8BWQ1|UD2A3_MOUSE UDP-glucuronosyltransferase 2A3 OS=Mus
musculus GN=Ugt2a3 PE=2 SV=1
Length = 534

Score = 32.3 bits (72), Expect = 1.6
Identities = 18/58 (31%), Positives = 25/58 (43%)
Frame = -3

Query: 485 CLCLFRKRFLCWSSLCFVGGVFVWEALFSRWEGLCL*T*ILGLRCREVGKVQYIPLVV 312
C+ F LCW+ F V VW S W L LG R EV ++Y +++
Sbjct: 6 CVAAFFLLQLCWAGCGFCSKVLVWPCDMSHWLNLKTILEELGARGHEVTVLKYPSIII 63


>sp|P43098|FAS2_CANAL Fatty acid synthase subunit alpha OS=Candida
albicans GN=FAS2 PE=3 SV=1
Length = 1885

Score = 32.3 bits (72), Expect = 1.6
Identities = 15/55 (27%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
Frame = +2

Query: 167 CTSYITKFDNTLIKAIKEQFDSCIENNATTYDRLRKIGNTIL-NTQQISSQQAVY 328
C + + + TLIK ++ D C E TY +++G ++ N +Q+ ++ VY
Sbjct: 435 CIQIMNRANPTLIKFMQYHIDHCPEYKGETYKLAKRLGQQLIDNCKQVLTEDPVY 489


>sp|Q6B8L1|TILS_GRATL tRNA(Ile)-lysidine synthase, chloroplastic
OS=Gracilaria tenuistipitata var. liui GN=tilS PE=3 SV=1
Length = 320

Score = 32.0 bits (71), Expect = 2.1
Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 1/110 (0%)
Frame = +2

Query: 164 YCTSYITKFDNTLIKAIKEQFDSCIENNATTYDRLRKIGNTILNTQQISSQQAVYIAL-S 340
Y T++ + L+ +KE F IE+N I+N +SS + YI S
Sbjct: 194 YYTNFRNRIRYELLPYLKEYFHPKIESN-------------IINFLSLSSIENEYIKQNS 240

Query: 341 LPLYIATREFMFINTNPPNERTMLPKRKHLLQNIDSTSIKIFYETSINKY 490
+ LY+A+R +I N + K +HL + + IF+ + NKY
Sbjct: 241 IKLYLASRHSHYIAIN-----YKIIKNQHLA--LQKRVLNIFFYHNFNKY 283


>sp|Q6AY26|CL032_RAT Uncharacterized protein C12orf32 homolog
OS=Rattus norvegicus PE=2 SV=1
Length = 235

Score = 30.8 bits (68), Expect = 4.6
Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 8/89 (8%)
Frame = +3

Query: 279 ETRY*THSK*AHNKRYILH--------FPYLSTSQPENLCS*TQTLPTREQCFPNENTSY 434
E+R+ TH K H++ H FP L+ PE+ S T L REQ +N+
Sbjct: 65 ESRFPTHRK--HHRDQARHPTRRSTCKFPRLTFESPESSSSETLLLSNREQL---QNSEK 119

Query: 435 KT*TRPA*KSFTKQA*TNTVNVLPSSMPH 521
RP F+ Q+ +P S+PH
Sbjct: 120 DAPRRPLVPLFSPQSCGELSVHVPQSLPH 148


>sp|Q54NP0|Y6352_DICDI Putative uncharacterized protein DDB_G0285119
OS=Dictyostelium discoideum GN=DDB_G0285119 PE=4 SV=1
Length = 521

Score = 30.4 bits (67), Expect = 6.1
Identities = 16/47 (34%), Positives = 23/47 (48%)
Frame = +1

Query: 268 SKNRKHDTKHTANKLTTSGIYCTFPTSLHRNPRIYVHKHKPSQRENN 408
+ N ++ + +KLT SG F S + N I V+ PSQ NN
Sbjct: 252 NNNNNNNNNNNTSKLTDSGKKPDFNNSNNSNSNINVNSVNPSQNNNN 298


>sp|Q5FF10|RUVC_EHRRG Crossover junction endodeoxyribonuclease ruvC
OS=Ehrlichia ruminantium (strain Gardel) GN=ruvC PE=3
SV=1
Length = 160

Score = 30.4 bits (67), Expect = 6.1
Identities = 27/85 (31%), Positives = 38/85 (44%)
Frame = +2

Query: 242 NNATTYDRLRKIGNTILNTQQISSQQAVYIALSLPLYIATREFMFINTNPPNERTMLPKR 421
N T +RL KI + +LN I S + A+ E +FIN NP + + R
Sbjct: 40 NKKTIGERLNKIYSELLN-----------ILNSYKVDTASMEEIFINKNPKSSTLLCYAR 88

Query: 422 KHLLQNIDSTSIKIFYETSINKYCK 496
LL +D I +F E S N+ K
Sbjct: 89 GILLLTLDVACIPLF-EYSANRVKK 112


>sp|O51879|MNMG_BUCAP tRNA uridine 5-carboxymethylaminomethyl
modification enzyme mnmG OS=Buchnera aphidicola subsp.
Schizaphis graminum GN=mnmG PE=3 SV=1
Length = 631

Score = 30.4 bits (67), Expect = 6.1
Identities = 14/29 (48%), Positives = 19/29 (65%)
Frame = +2

Query: 14 AISSRISCQTLLLKRNIKDIYTNNLNPTI 100
A S+R+ C+TLLL + I DI + NP I
Sbjct: 25 AASARVGCKTLLLTQKITDIGVLSCNPAI 53


>sp|Q4IR09|RNA14_GIBZE mRNA 3'-end-processing protein RNA14
OS=Gibberella zeae GN=RNA14 PE=3 SV=1
Length = 997

Score = 30.0 bits (66), Expect = 8.0
Identities = 15/46 (32%), Positives = 24/46 (52%)
Frame = +2

Query: 389 PPNERTMLPKRKHLLQNIDSTSIKIFYETSINKYCKRPAQLNAASL 526
P +E M+ K+L D+T+ ++ +ET IN+ P L A L
Sbjct: 671 PNDEMFMIEYLKYLHSKDDTTNARVVFETCINRLVSNPDTLAKAKL 716


tr_hit_id Q7M562
Definition tr|Q7M562|Q7M562_DANRE Replicase/helicase/endonuclease OS=Danio rerio
Align length 184
Score (bit) 91.3
E-value 3.0e-17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916802|Adiantum capillus-veneris mRNA, clone:
YMU001_000091_G07.
(556 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q7M562|Q7M562_DANRE Replicase/helicase/endonuclease OS=Danio ... 91 3e-17
tr|Q7M561|Q7M561_DANRE Replicase/helicase/endonuclease OS=Danio ... 91 3e-17
tr|Q7M560|Q7M560_DANRE Replicase/helicase/endonuclease OS=Danio ... 87 5e-16
tr|Q7M559|Q7M559_DANRE Replicase/helicase/endonuclease OS=Danio ... 87 8e-16
tr|B0WH72|B0WH72_CULQU Putative uncharacterized protein OS=Culex... 87 8e-16
tr|B0XKN7|B0XKN7_CULQU Putative uncharacterized protein OS=Culex... 84 5e-15
tr|B0XE87|B0XE87_CULQU Putative uncharacterized protein OS=Culex... 84 5e-15
tr|B0XBP3|B0XBP3_CULQU Putative uncharacterized protein OS=Culex... 84 5e-15
tr|B0X8F9|B0X8F9_CULQU Putative uncharacterized protein OS=Culex... 84 5e-15
tr|B0X3H8|B0X3H8_CULQU Putative uncharacterized protein OS=Culex... 84 5e-15
tr|B0W9W4|B0W9W4_CULQU Putative uncharacterized protein OS=Culex... 82 1e-14
tr|B0W7Q6|B0W7Q6_CULQU Putative uncharacterized protein OS=Culex... 82 1e-14
tr|Q7M558|Q7M558_DANRE Replicase/helicase/endonuclease OS=Danio ... 81 3e-14
tr|Q38JW4|Q38JW4_XIPMA Hel OS=Xiphophorus maculatus GN=Hel PE=4 ... 78 4e-13
tr|B0X370|B0X370_CULQU Putative uncharacterized protein OS=Culex... 62 2e-08
tr|B0X2H4|B0X2H4_CULQU Putative uncharacterized protein OS=Culex... 62 2e-08
tr|B0WS82|B0WS82_CULQU Putative uncharacterized protein OS=Culex... 62 2e-08
tr|B0WHR0|B0WHR0_CULQU Putative uncharacterized protein OS=Culex... 61 4e-08
tr|B0WBF3|B0WBF3_CULQU Putative uncharacterized protein OS=Culex... 61 4e-08
tr|B4NMA4|B4NMA4_DROWI GK22626 OS=Drosophila willistoni GN=GK226... 54 7e-06
tr|Q2H1C4|Q2H1C4_CHAGB Putative uncharacterized protein OS=Chaet... 51 4e-05
tr|Q2H197|Q2H197_CHAGB Putative uncharacterized protein OS=Chaet... 51 4e-05
tr|Q2GR48|Q2GR48_CHAGB Putative uncharacterized protein OS=Chaet... 50 1e-04
tr|Q2GWU1|Q2GWU1_CHAGB Putative uncharacterized protein OS=Chaet... 49 1e-04
tr|Q2H764|Q2H764_CHAGB Putative uncharacterized protein OS=Chaet... 49 2e-04
tr|Q2GUR6|Q2GUR6_CHAGB Putative uncharacterized protein OS=Chaet... 49 2e-04
tr|B7QBG5|B7QBG5_IXOSC Putative uncharacterized protein OS=Ixode... 48 3e-04
tr|B0WJB6|B0WJB6_CULQU Putative uncharacterized protein OS=Culex... 43 0.010
tr|B0XLK1|B0XLK1_CULQU Putative uncharacterized protein OS=Culex... 42 0.022
tr|Q2GTI6|Q2GTI6_CHAGB Putative uncharacterized protein OS=Chaet... 40 0.065

>tr|Q7M562|Q7M562_DANRE Replicase/helicase/endonuclease OS=Danio rerio
GN=hel_dr1 PE=4 SV=1
Length = 2289

Score = 91.3 bits (225), Expect = 3e-17
Identities = 57/184 (30%), Positives = 92/184 (50%), Gaps = 2/184 (1%)
Frame = +2

Query: 2 DYIEAISSRISCQTLLLKRNIKDIYTNNLNPTISKLWDANSDIQYILNAHGAAIYCTSYI 181
DY+ + +LLKR+ K+ + N NP + + W+AN DIQYIL+A+ +Y SY+
Sbjct: 1204 DYLNYAEGLTTGSAVLLKRDPKETWVNGYNPDLLRAWNANMDIQYILDAYSCIMYMLSYV 1263

Query: 182 TKFDNTLIKAIKEQFDSCIENNATTYDRLRKIGNTILNTQQISSQQAVYIALSLPLYIAT 361
+K ++ + +K S E N D ++ I +Q+S+Q++V SLPL +
Sbjct: 1264 SKPEHEMSGFLKNVIQSVREANVNEEDEMKHIMQAYAKHRQVSAQESVARTCSLPLKKCS 1323

Query: 362 REFMFINTNPPNERTMLPKRKHLLQNIDSTSIKIFYETSINKYCKRPAQL--NAASLTEF 535
R +F+ T+ + LP +L N + S ++ I KY RP L L +F
Sbjct: 1324 RSVVFVPTDDDALKMSLP--ISVLLNKNPESEDVWMSGLIEKYRARPLTLEFEKMCLADF 1381

Query: 536 ASTY 547
AS Y
Sbjct: 1382 ASNY 1385


>tr|Q7M561|Q7M561_DANRE Replicase/helicase/endonuclease OS=Danio rerio
GN=hel_dr2 PE=4 SV=1
Length = 2181

Score = 91.3 bits (225), Expect = 3e-17
Identities = 57/184 (30%), Positives = 92/184 (50%), Gaps = 2/184 (1%)
Frame = +2

Query: 2 DYIEAISSRISCQTLLLKRNIKDIYTNNLNPTISKLWDANSDIQYILNAHGAAIYCTSYI 181
DY+ + +LLKR+ K+ + N NP + + W+AN DIQYIL+A+ +Y SY+
Sbjct: 1096 DYLNYAEGLTTGSAVLLKRDPKETWVNGYNPDLLRAWNANMDIQYILDAYSCIMYMLSYV 1155

Query: 182 TKFDNTLIKAIKEQFDSCIENNATTYDRLRKIGNTILNTQQISSQQAVYIALSLPLYIAT 361
+K ++ + +K S E N D ++ I +Q+S+Q++V SLPL +
Sbjct: 1156 SKPEHEMSGFLKNVIQSVREANVNEEDEMKHIMQAYAKHRQVSAQESVARTCSLPLKKCS 1215

Query: 362 REFMFINTNPPNERTMLPKRKHLLQNIDSTSIKIFYETSINKYCKRPAQL--NAASLTEF 535
R +F+ T+ + LP +L N + S ++ I KY RP L L +F
Sbjct: 1216 RSVVFVPTDDDALKMSLP--ISVLLNKNPESEDVWMSGLIEKYRARPLTLEFEKMCLADF 1273

Query: 536 ASTY 547
AS Y
Sbjct: 1274 ASNY 1277


>tr|Q7M560|Q7M560_DANRE Replicase/helicase/endonuclease OS=Danio rerio
GN=hel_dr3 PE=4 SV=1
Length = 2353

Score = 87.4 bits (215), Expect = 5e-16
Identities = 54/183 (29%), Positives = 95/183 (51%), Gaps = 2/183 (1%)
Frame = +2

Query: 5 YIEAISSRISCQTLLLKRNIKDIYTNNLNPTISKLWDANSDIQYILNAHGAAIYCTSYIT 184
YIE +S T++++R +D + N NP + K W+AN DIQ+ILN + +Y SYI+
Sbjct: 1268 YIECMSKS---NTIVMERRPQDCWVNGYNPLLLKAWNANMDIQFILNPYSCIMYILSYIS 1324

Query: 185 KFDNTLIKAIKEQFDSCIENNATTYDRLRKIGNTILNTQQISSQQAVYIALSLPLYIATR 364
K ++ + +K +N + + ++++ N +++S+Q+AV SL L ++R
Sbjct: 1325 KAEHEMSDYLKRVMKDSSHDNLSESECMKQVMNAYSKNREVSAQEAVARTCSLKLKSSSR 1384

Query: 365 EFMFINTNPPNERTMLPKRKHLLQNIDSTSIKIFYETSINKYCKRPA--QLNAASLTEFA 538
+FI T+ + LP + LQ +D ++ +KY RPA + + EFA
Sbjct: 1385 AVIFIPTDDNAVKMSLPMK--YLQAMDDDVENVWMTGLPDKYKARPARPEFENLCMAEFA 1442

Query: 539 STY 547
S Y
Sbjct: 1443 SEY 1445


>tr|Q7M559|Q7M559_DANRE Replicase/helicase/endonuclease OS=Danio rerio
GN=hel_dr4 PE=4 SV=1
Length = 2783

Score = 86.7 bits (213), Expect = 8e-16
Identities = 52/184 (28%), Positives = 93/184 (50%), Gaps = 2/184 (1%)
Frame = +2

Query: 2 DYIEAISSRISCQTLLLKRNIKDIYTNNLNPTISKLWDANSDIQYILNAHGAAIYCTSYI 181
DY I + ++++R +D + N NP + + W+AN DIQ+ILN + +Y SYI
Sbjct: 1700 DYENHIDALSKSSVIVMERQPQDCWVNGYNPLLLRAWNANMDIQFILNPYSCIMYMLSYI 1759

Query: 182 TKFDNTLIKAIKEQFDSCIENNATTYDRLRKIGNTILNTQQISSQQAVYIALSLPLYIAT 361
+K ++ + +K ++ T + ++K+ N +++S+Q+AV SL L ++
Sbjct: 1760 SKAEHEMSDYLKTVIRGSSHDDLTDRECMKKVMNAYSKNREVSAQEAVARTCSLKLKSSS 1819

Query: 362 REFMFINTNPPNERTMLPKRKHLLQNIDSTSIKIFYETSINKYCKRP--AQLNAASLTEF 535
R +FI T+ + LP + LQN+D ++ +KY RP + + EF
Sbjct: 1820 RAVIFIPTDDNAVKMSLPMK--YLQNMDDDVENVWMTGLPDKYKARPNRPEFENMCMAEF 1877

Query: 536 ASTY 547
AS Y
Sbjct: 1878 ASEY 1881


>tr|B0WH72|B0WH72_CULQU Putative uncharacterized protein OS=Culex
quinquefasciatus GN=CpipJ_CPIJ006540 PE=4 SV=1
Length = 2294

Score = 86.7 bits (213), Expect = 8e-16
Identities = 57/179 (31%), Positives = 89/179 (49%)
Frame = +2

Query: 5 YIEAISSRISCQTLLLKRNIKDIYTNNLNPTISKLWDANSDIQYILNAHGAAIYCTSYIT 184
Y AI S + TL+ KR DI N+ N + L ++N D+Q+IL+ + A Y Y+
Sbjct: 960 YKTAIRSALDRPTLIYKRRSCDIDINSYNLELLNLMESNIDVQFILDKYQTAQYVVDYVV 1019

Query: 185 KFDNTLIKAIKEQFDSCIENNATTYDRLRKIGNTILNTQQISSQQAVYIALSLPLYIATR 364
K D L KA+K+ + N + +++R N LN +S+ +AV LS+PL
Sbjct: 1020 KPDTGLSKALKDIQAELDKGNVSAREQMRTYTNKFLNGHLLSTSEAVMYCLSIPLTRFKV 1079

Query: 365 EFMFINTNPPNERTMLPKRKHLLQNIDSTSIKIFYETSINKYCKRPAQLNAASLTEFAS 541
+FINT P ER + K L+ +D S + + I Y +R ++ L EFA+
Sbjct: 1080 ASIFINTAPKEERVVFLKSVKELEALDPDSTDVCGKDVITHYAERKG-MDDVCLAEFAA 1137


>tr|B0XKN7|B0XKN7_CULQU Putative uncharacterized protein OS=Culex
quinquefasciatus GN=CpipJ_CPIJ019992 PE=4 SV=1
Length = 1820

Score = 84.0 bits (206), Expect = 5e-15
Identities = 54/186 (29%), Positives = 92/186 (49%), Gaps = 5/186 (2%)
Frame = +2

Query: 5 YIEAISSRISCQTLLLKRNIKDIYTNNLNPTISKLWDANSDIQYILNAHGAAIYCTSYIT 184
Y+E I + + KR + +Y N N I + +NSD+Q+I++ + A Y Y+
Sbjct: 828 YLEVIRAWLQRPAFFFKRPMNQLYMNPFNVWIGGVLRSNSDLQFIMDEYSCASYLVDYVN 887

Query: 185 KFDNTLIKAIKEQFDSCIENNATTYDR---LRKIGNTILNTQQISSQQAVYIALSLPLYI 355
K + + +E + ++ YD L+K+G +LN+ ++ SQ+A +I L LP+
Sbjct: 888 KTNRGISAFHRELLE--LQEQYPDYDYQGLLKKLGVRVLNSVEMCSQEAAWILLRLPMSE 945

Query: 356 ATREFMFINTNPPNERTMLPKRKHLLQN--IDSTSIKIFYETSINKYCKRPAQLNAASLT 529
A+R+ F+ T PNERT KR + N +D S ++ + KY R L L
Sbjct: 946 ASRKIEFVPTMWPNERTRCRKRHQQMDNEGLDDDSTDVWTRNIVQKYEDRDG-LEDVCLA 1004

Query: 530 EFASTY 547
+F + Y
Sbjct: 1005 DFVAWY 1010


>tr|B0XE87|B0XE87_CULQU Putative uncharacterized protein OS=Culex
quinquefasciatus GN=CpipJ_CPIJ017591 PE=4 SV=1
Length = 1948

Score = 84.0 bits (206), Expect = 5e-15
Identities = 54/186 (29%), Positives = 92/186 (49%), Gaps = 5/186 (2%)
Frame = +2

Query: 5 YIEAISSRISCQTLLLKRNIKDIYTNNLNPTISKLWDANSDIQYILNAHGAAIYCTSYIT 184
Y+E I + + KR + +Y N N I + +NSD+Q+I++ + A Y Y+
Sbjct: 828 YLEVIRAWLQRPAFFFKRPMNQLYMNPFNVWIGGVLRSNSDLQFIMDEYSCASYLVDYVN 887

Query: 185 KFDNTLIKAIKEQFDSCIENNATTYDR---LRKIGNTILNTQQISSQQAVYIALSLPLYI 355
K + + +E + ++ YD L+K+G +LN+ ++ SQ+A +I L LP+
Sbjct: 888 KTNRGISAFHRELLE--LQEQYPDYDYQGLLKKLGVRVLNSVEMCSQEAAWILLRLPMSE 945

Query: 356 ATREFMFINTNPPNERTMLPKRKHLLQN--IDSTSIKIFYETSINKYCKRPAQLNAASLT 529
A+R+ F+ T PNERT KR + N +D S ++ + KY R L L
Sbjct: 946 ASRKIEFVPTMWPNERTRCRKRHQQMDNEGLDDDSTDVWTRNIVQKYEDRDG-LEDVCLA 1004

Query: 530 EFASTY 547
+F + Y
Sbjct: 1005 DFVAWY 1010


>tr|B0XBP3|B0XBP3_CULQU Putative uncharacterized protein OS=Culex
quinquefasciatus GN=CpipJ_CPIJ016814 PE=4 SV=1
Length = 1966

Score = 84.0 bits (206), Expect = 5e-15
Identities = 54/186 (29%), Positives = 92/186 (49%), Gaps = 5/186 (2%)
Frame = +2

Query: 5 YIEAISSRISCQTLLLKRNIKDIYTNNLNPTISKLWDANSDIQYILNAHGAAIYCTSYIT 184
Y+E I + + KR + +Y N N I + +NSD+Q+I++ + A Y Y+
Sbjct: 794 YLEVIRAWLQRPAFFFKRPMNQLYMNPFNVWIGGVLRSNSDLQFIMDEYSCASYLVDYVN 853

Query: 185 KFDNTLIKAIKEQFDSCIENNATTYDR---LRKIGNTILNTQQISSQQAVYIALSLPLYI 355
K + + +E + ++ YD L+K+G +LN+ ++ SQ+A +I L LP+
Sbjct: 854 KTNRGISAFHRELLE--LQEQYPDYDYQGLLKKLGVRVLNSVEMCSQEATWILLRLPMSE 911

Query: 356 ATREFMFINTNPPNERTMLPKRKHLLQN--IDSTSIKIFYETSINKYCKRPAQLNAASLT 529
A+R+ F+ T PNERT KR + N +D S ++ + KY R L L
Sbjct: 912 ASRKIEFVPTMWPNERTRCRKRHQQMDNEGLDDDSTDVWTRNIVQKYEDRDG-LEDVCLA 970

Query: 530 EFASTY 547
+F + Y
Sbjct: 971 DFVAWY 976


>tr|B0X8F9|B0X8F9_CULQU Putative uncharacterized protein OS=Culex
quinquefasciatus GN=CpipJ_CPIJ015439 PE=4 SV=1
Length = 1984

Score = 84.0 bits (206), Expect = 5e-15
Identities = 54/186 (29%), Positives = 92/186 (49%), Gaps = 5/186 (2%)
Frame = +2

Query: 5 YIEAISSRISCQTLLLKRNIKDIYTNNLNPTISKLWDANSDIQYILNAHGAAIYCTSYIT 184
Y+E I + + KR + +Y N N I + +NSD+Q+I++ + A Y Y+
Sbjct: 845 YLEVIRAWLQRPAFFFKRPMNQLYMNPFNVWIGGVLRSNSDLQFIMDEYSCASYLVDYVN 904

Query: 185 KFDNTLIKAIKEQFDSCIENNATTYDR---LRKIGNTILNTQQISSQQAVYIALSLPLYI 355
K + + +E + ++ YD L+K+G +LN+ ++ SQ+A +I L LP+
Sbjct: 905 KTNRGISAFHRELLE--LQEQYPDYDYQGLLKKLGVRVLNSVEMCSQEAAWILLRLPMSE 962

Query: 356 ATREFMFINTNPPNERTMLPKRKHLLQN--IDSTSIKIFYETSINKYCKRPAQLNAASLT 529
A+R+ F+ T PNERT KR + N +D S ++ + KY R L L
Sbjct: 963 ASRKIEFVPTMWPNERTRCRKRHQQMDNEGLDDDSTDVWTRNIVQKYEDRDG-LEDVCLA 1021

Query: 530 EFASTY 547
+F + Y
Sbjct: 1022 DFVAWY 1027


>tr|B0X3H8|B0X3H8_CULQU Putative uncharacterized protein OS=Culex
quinquefasciatus GN=CpipJ_CPIJ014171 PE=4 SV=1
Length = 1866

Score = 84.0 bits (206), Expect = 5e-15
Identities = 54/186 (29%), Positives = 92/186 (49%), Gaps = 5/186 (2%)
Frame = +2

Query: 5 YIEAISSRISCQTLLLKRNIKDIYTNNLNPTISKLWDANSDIQYILNAHGAAIYCTSYIT 184
Y+E I + + KR + +Y N N I + +NSD+Q+I++ + A Y Y+
Sbjct: 787 YLEVIRAWLQRPAFFFKRPMNQLYINPFNVWIGGVLRSNSDLQFIMDEYSCASYLVDYVN 846

Query: 185 KFDNTLIKAIKEQFDSCIENNATTYDR---LRKIGNTILNTQQISSQQAVYIALSLPLYI 355
K + + +E + ++ YD L+K+G +LN+ ++ SQ+A +I L LP+
Sbjct: 847 KTNRGISAFHRELLE--LQEQYPDYDYQGLLKKLGVRVLNSVEMCSQEAAWILLRLPMSE 904

Query: 356 ATREFMFINTNPPNERTMLPKRKHLLQN--IDSTSIKIFYETSINKYCKRPAQLNAASLT 529
A+R+ F+ T PNERT KR + N +D S ++ + KY R L L
Sbjct: 905 ASRKIEFVPTMWPNERTRCRKRHEQMDNEGLDDDSTDVWTRNIVQKYEDRDG-LEDVCLA 963

Query: 530 EFASTY 547
+F + Y
Sbjct: 964 DFVAWY 969