BP916824
Clone id YMU001_000092_B07
Library
Length 265
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000092_B07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGATGGTCAGCTTGATGGCTGGAGTTAAATTTCGAGCACTACCTCCAGCGTGGCGGAGGT
AGTGCCCTGCCAACATGCAACAAAGGTATATGCCAAACCTCGATTAAATCGAAAATCCTA
AACCTCGACTTGAGTACACTCTTGCGAGTGACTTTTAATAACAATAGACTAAAGAAACAT
GAGGAGGTTAGGGTTTCCTTTTCCCCAAGCCTTGATGGTTGGTTCCTCTCTAGCCAGCTC
TGATACGGGTATGCCCTCACACTTT
■■Homology search results ■■ -
sp_hit_id Q10415
Definition sp|Q10415|PMIP_SCHPO Mitochondrial intermediate peptidase OS=Schizosaccharomyces pombe
Align length 35
Score (bit) 30.4
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916824|Adiantum capillus-veneris mRNA, clone:
YMU001_000092_B07.
(265 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q10415|PMIP_SCHPO Mitochondrial intermediate peptidase OS=Sch... 30 2.9

>sp|Q10415|PMIP_SCHPO Mitochondrial intermediate peptidase
OS=Schizosaccharomyces pombe GN=oct1 PE=2 SV=1
Length = 762

Score = 30.4 bits (67), Expect = 2.9
Identities = 14/35 (40%), Positives = 22/35 (62%)
Frame = +1

Query: 118 LNLDLSTLLRVTFNNNRLKKHEEVRVSFSPSLDGW 222
L+L S++L+ NN L K +E+ ++F PS D W
Sbjct: 343 LSLKNSSVLKKILNNLALMKKKELNLNFLPSFDVW 377


tr_hit_id Q4XXA7
Definition tr|Q4XXA7|Q4XXA7_PLACH Putative uncharacterized protein (Fragment) OS=Plasmodium chabaudi
Align length 78
Score (bit) 33.5
E-value 5.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916824|Adiantum capillus-veneris mRNA, clone:
YMU001_000092_B07.
(265 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4XXA7|Q4XXA7_PLACH Putative uncharacterized protein (Fragmen... 33 5.4
tr|A7SS38|A7SS38_NEMVE Predicted protein OS=Nematostella vectens... 33 5.4

>tr|Q4XXA7|Q4XXA7_PLACH Putative uncharacterized protein (Fragment)
OS=Plasmodium chabaudi GN=PC001077.02.0 PE=4 SV=1
Length = 496

Score = 33.5 bits (75), Expect = 5.4
Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 10/78 (12%)
Frame = +1

Query: 37 HYLQRGGGSALP---TCNKGICQTSIKSKILNLDLSTLLRV-TFNNNRLKKHEEVRV--- 195
HY +RG S + TC+KGI S+ K +L LLR +NNN LKK ++ V
Sbjct: 195 HY-ERGYASDISIEETCDKGIVDNSMMIKDKGNNLINLLRFKIYNNNFLKKQDKYVVKRK 253

Query: 196 ---SFSPSLDGWFLSSQL 240
S + SL+ +FL + +
Sbjct: 254 RSFSVNSSLNEYFLETDM 271


>tr|A7SS38|A7SS38_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g216602 PE=4 SV=1
Length = 344

Score = 33.5 bits (75), Expect = 5.4
Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 4/61 (6%)
Frame = +1

Query: 37 HYLQRGGGSALPT----CNKGICQTSIKSKILNLDLSTLLRVTFNNNRLKKHEEVRVSFS 204
HY + G A + C+ G C + + LN+D L TF+ NRLK+ + S
Sbjct: 238 HYYYKNGELAKRSTGCECHNGNCGCCLHIQFLNIDDDVCLNSTFDANRLKRRNKKGFSIK 297

Query: 205 P 207
P
Sbjct: 298 P 298