BP916837
Clone id YMU001_000092_C11
Library
Length 381
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000092_C11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTACACAAAGACAACCTGGCTCTTGAAAAGAGTATTACACCCACCCCTCCTACATGCATA
ATTCCCAAGCACAAAAGAACCATACTTGAAATGCATATGGTACCATATTCCTGACATAGA
AGTACCGCAAGGTATGGAGCCTTCTCCCAATGTTCACTTTACCCTACTACCAATTCTGTC
CCAATACTCATACTACCAATTCTGTCAGCATAATCTACTGATGAGAGTTCCATCTGAACC
AGCACCTTATCATTCCCTTATCAAGAAGACATGTGTAAAGAAAACAGACCACTACTGACA
ATTCACAATGAAATCGGTTCCCACTTTCAAGAAGCTCATCATTCTCTCATCAAGAGCACA
TGAGAGAAGCGAGGCAGTCTG
■■Homology search results ■■ -
sp_hit_id Q96RN5
Definition sp|Q96RN5|MED15_HUMAN Mediator of RNA polymerase II transcription subunit 15 OS=Homo sapiens
Align length 47
Score (bit) 29.6
E-value 4.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916837|Adiantum capillus-veneris mRNA, clone:
YMU001_000092_C11.
(381 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q96RN5|MED15_HUMAN Mediator of RNA polymerase II transcriptio... 30 4.8
sp|O84119|INCF_CHLTR Inclusion membrane protein F OS=Chlamydia t... 29 6.3

>sp|Q96RN5|MED15_HUMAN Mediator of RNA polymerase II transcription
subunit 15 OS=Homo sapiens GN=MED15 PE=1 SV=2
Length = 788

Score = 29.6 bits (65), Expect = 4.8
Identities = 17/47 (36%), Positives = 23/47 (48%)
Frame = +2

Query: 107 IPDIEVPQGMEPSPNVHFTLLPILSQYSYYQFCQHNLLMRVPSEPAP 247
IP +P G +P V + LP+LS S Q Q M P +P+P
Sbjct: 410 IPSSSIPLGRQPMAQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSP 456


>sp|O84119|INCF_CHLTR Inclusion membrane protein F OS=Chlamydia
trachomatis GN=incF PE=4 SV=1
Length = 104

Score = 29.3 bits (64), Expect = 6.3
Identities = 12/34 (35%), Positives = 20/34 (58%)
Frame = -2

Query: 104 GTICISSMVLLCLGIMHVGGVGVILFSRARLSLC 3
G +C+ S+V LC+G VG + V++ + LC
Sbjct: 50 GALCVLSLVALCVGATPVGPLAVLVATTLASFLC 83


tr_hit_id A9LDS1
Definition tr|A9LDS1|A9LDS1_GASAC Suppressor of cytokine signaling 9 OS=Gasterosteus aculeatus
Align length 62
Score (bit) 32.7
E-value 9.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916837|Adiantum capillus-veneris mRNA, clone:
YMU001_000092_C11.
(381 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9LDS1|A9LDS1_GASAC Suppressor of cytokine signaling 9 OS=Gas... 33 9.1
tr|Q54B34|Q54B34_DICDI Putative uncharacterized protein OS=Dicty... 33 9.1

>tr|A9LDS1|A9LDS1_GASAC Suppressor of cytokine signaling 9
OS=Gasterosteus aculeatus GN=SOCS9 PE=2 SV=1
Length = 533

Score = 32.7 bits (73), Expect = 9.1
Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 4/62 (6%)
Frame = +2

Query: 116 IEVPQGMEPSPNVHFTLLPILSQ----YSYYQFCQHNLLMRVPSEPAPYHSLIKKTCVKK 283
I + QG+EP PN + +Q Y + H + ++ AP+H L+ ++C+
Sbjct: 240 ISIEQGVEPPPNAEIHTFEVTAQINPLYKHGPKLAHGMNELAGADRAPHHQLLLQSCLDT 299

Query: 284 TD 289
D
Sbjct: 300 LD 301


>tr|Q54B34|Q54B34_DICDI Putative uncharacterized protein
OS=Dictyostelium discoideum GN=DDB_0192205 PE=4 SV=1
Length = 319

Score = 32.7 bits (73), Expect = 9.1
Identities = 15/48 (31%), Positives = 24/48 (50%)
Frame = +2

Query: 152 VHFTLLPILSQYSYYQFCQHNLLMRVPSEPAPYHSLIKKTCVKKTDHY 295
+ F + + + Y+FC H R+P E +H + TCV K DH+
Sbjct: 118 IEFKSIKTIKRSETYRFCIH---CRLPKEERTHHCQLCGTCVLKMDHH 162