BP916864
Clone id YMU001_000092_G11
Library
Length 404
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000092_G11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATAATCCATTTGATACATAAACTTTGCCATCTCCATTCAAAATCTTGAGAAACAGGTAAT
GATAAAATCTGCAAACCATTGACGGGAGCTCAACTCCTACAACACTGCAGAGACCCTGGA
ATCATACAAGTTAACAAGACTATTAGCAGTAGAGATGTCCTTTAAGTTGGATAAAGCTAG
TAAATTTGTACAAGGCTCTAAAACCCCGACTCCCTCTGATCACAATAATATGTGTAACCT
AGCCTGTGACAATCTGTCAGCGTCCAGCAGGCTTCCACAACGATAAGCCATGCGCCACTT
TGCCTTTCCAGCATAGCAGCATCCAGGACCCATCTTCGTCCACACTAAAATTCTTGCTGT
AACCGCACCTGACAATAGTTTGAGACTCATTTAGAGCCTTTCGA
■■Homology search results ■■ -
sp_hit_id Q9LTI5
Definition sp|Q9LTI5|SCL11_ARATH Scarecrow-like protein 11 OS=Arabidopsis thaliana
Align length 46
Score (bit) 51.2
E-value 2.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916864|Adiantum capillus-veneris mRNA, clone:
YMU001_000092_G11.
(404 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LTI5|SCL11_ARATH Scarecrow-like protein 11 OS=Arabidopsis t... 51 2e-06
sp|Q9XE58|SCL14_ARATH Scarecrow-like protein 14 OS=Arabidopsis t... 49 1e-05
sp|Q9SNB8|SCL30_ARATH Scarecrow-like protein 30 OS=Arabidopsis t... 47 3e-05
sp|O80933|SCL9_ARATH Scarecrow-like protein 9 OS=Arabidopsis tha... 43 6e-04
sp|P0C883|SCL33_ARATH Scarecrow-like protein 33 OS=Arabidopsis t... 43 6e-04
sp|Q3EDH0|SCL31_ARATH Scarecrow-like protein 31 OS=Arabidopsis t... 41 0.002
sp|P0C884|SCL34_ARATH Scarecrow-like protein 34 OS=Arabidopsis t... 39 0.006
sp|Q9CM98|PROA_PASMU Gamma-glutamyl phosphate reductase OS=Paste... 30 2.8
sp|Q1L8H0|LR14L_DANRE Leucine-rich repeat-containing protein 14-... 30 2.8
sp|P50237|ST1C1_RAT Sulfotransferase 1C1 OS=Rattus norvegicus GN... 29 8.2
sp|Q80VR3|ST1C1_MOUSE Sulfotransferase 1C1 OS=Mus musculus GN=Su... 29 8.2

>sp|Q9LTI5|SCL11_ARATH Scarecrow-like protein 11 OS=Arabidopsis
thaliana GN=SCL11 PE=2 SV=1
Length = 610

Score = 51.2 bits (121), Expect = 2e-06
Identities = 20/46 (43%), Positives = 31/46 (67%)
Frame = -2

Query: 403 RKALNESQTIVRCGYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKPA 266
++ + E++ IVR Y ++F +D D +WML WKG+V + S WKPA
Sbjct: 555 KQIMKEAKEIVRKRYHRDFVIDSDNNWMLQGWKGRVIYAFSCWKPA 600


>sp|Q9XE58|SCL14_ARATH Scarecrow-like protein 14 OS=Arabidopsis
thaliana GN=SCL14 PE=2 SV=2
Length = 769

Score = 48.5 bits (114), Expect = 1e-05
Identities = 17/33 (51%), Positives = 25/33 (75%)
Frame = -2

Query: 364 GYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKPA 266
GY KNF VD++G+W+L WKG++ + SLW P+
Sbjct: 735 GYDKNFDVDQNGNWLLQGWKGRIVYASSLWVPS 767


>sp|Q9SNB8|SCL30_ARATH Scarecrow-like protein 30 OS=Arabidopsis
thaliana GN=SCL30 PE=2 SV=1
Length = 583

Score = 47.0 bits (110), Expect = 3e-05
Identities = 18/46 (39%), Positives = 29/46 (63%)
Frame = -2

Query: 403 RKALNESQTIVRCGYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKPA 266
++ + + + IV+ Y K+F +D D WM WKG+V + +S WKPA
Sbjct: 536 KQIVKDGKEIVKERYHKDFVIDNDNHWMFQGWKGRVLYAVSCWKPA 581


>sp|O80933|SCL9_ARATH Scarecrow-like protein 9 OS=Arabidopsis
thaliana GN=SCL9 PE=2 SV=1
Length = 718

Score = 42.7 bits (99), Expect = 6e-04
Identities = 15/34 (44%), Positives = 22/34 (64%)
Frame = -2

Query: 361 YSKNFSVDEDGSWMLLCWKGKVAHGLSLWKPAGR 260
Y K+F +D+D W+L WKG+ LS+WKP +
Sbjct: 684 YHKDFVIDQDNRWLLQGWKGRTVMALSVWKPESK 717


>sp|P0C883|SCL33_ARATH Scarecrow-like protein 33 OS=Arabidopsis
thaliana GN=SCL33 PE=3 SV=1
Length = 694

Score = 42.7 bits (99), Expect = 6e-04
Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
Frame = -2

Query: 403 RKALNESQTIVRCGYS-KNFSVDEDGSWMLLCWKGKVAHGLSLWKP 269
++ + + + +V GY K F VD+D W+L WKG++ +G S+W P
Sbjct: 648 KELVQKLKLMVESGYKPKEFDVDQDCHWLLQGWKGRIVYGSSIWVP 693


>sp|Q3EDH0|SCL31_ARATH Scarecrow-like protein 31 OS=Arabidopsis
thaliana GN=SCL31 PE=2 SV=1
Length = 695

Score = 40.8 bits (94), Expect = 0.002
Identities = 15/33 (45%), Positives = 21/33 (63%)
Frame = -2

Query: 364 GYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKPA 266
GY K+F +DED +W L WKG++ S W P+
Sbjct: 663 GYHKDFVLDEDSNWFLQGWKGRILFSSSCWVPS 695


>sp|P0C884|SCL34_ARATH Scarecrow-like protein 34 OS=Arabidopsis
thaliana GN=SCL34 PE=3 SV=1
Length = 630

Score = 39.3 bits (90), Expect = 0.006
Identities = 15/32 (46%), Positives = 20/32 (62%)
Frame = -2

Query: 361 YSKNFSVDEDGSWMLLCWKGKVAHGLSLWKPA 266
Y K+F VDE+ W+L WKG+ + S W PA
Sbjct: 599 YHKDFVVDENSKWLLQGWKGRTLYASSCWVPA 630


>sp|Q9CM98|PROA_PASMU Gamma-glutamyl phosphate reductase
OS=Pasteurella multocida GN=proA PE=3 SV=1
Length = 420

Score = 30.4 bits (67), Expect = 2.8
Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 3/60 (5%)
Frame = +2

Query: 143 LAVEMSFKLDKASKFVQGSKTPTPSDHNNMCNLACDNLSASSRLP---QR*AMRHFAFPA 313
L +E S LDKA ++ +KT PS N + L A+ LP Q + +H F A
Sbjct: 230 LFIEQSADLDKALPLIENAKTQRPSTCNTLETLLVQRAIATQFLPKLAQHLSAKHVKFHA 289


>sp|Q1L8H0|LR14L_DANRE Leucine-rich repeat-containing protein
14-like OS=Danio rerio GN=si:dkey-231l1.3 PE=3 SV=1
Length = 526

Score = 30.4 bits (67), Expect = 2.8
Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 2/66 (3%)
Frame = -3

Query: 327 PGCCYAGKAKWRMAYRCGSLLDADRLSQARLHI--LL*SEGVGVLEPCTNLLALSNLKDI 154
P CY + + R D+D+ QAR + +L EG G +E CT LL + +
Sbjct: 429 PRDCYPESVTYPLDDRTLVNYDSDKFQQARTELVGILEREGKGHVEVCTPLLGVYDADIN 488

Query: 153 STANSL 136
T+N L
Sbjct: 489 ETSNEL 494


>sp|P50237|ST1C1_RAT Sulfotransferase 1C1 OS=Rattus norvegicus
GN=Sult1c1 PE=1 SV=1
Length = 304

Score = 28.9 bits (63), Expect = 8.2
Identities = 11/29 (37%), Positives = 17/29 (58%)
Frame = -1

Query: 296 GAWLIVVEACWTLTDCHRLGYTYYCDQRE 210
G+W V+ W + D HR+ Y +Y D +E
Sbjct: 179 GSWYDHVKGWWDVKDQHRILYLFYEDMKE 207


tr_hit_id A3E2G2
Definition tr|A3E2G2|A3E2G2_PINRA SCARECROW-like protein 1 OS=Pinus radiata
Align length 46
Score (bit) 58.2
E-value 2.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916864|Adiantum capillus-veneris mRNA, clone:
YMU001_000092_G11.
(404 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A3E2G2|A3E2G2_PINRA SCARECROW-like protein 1 OS=Pinus radiata... 58 2e-07
tr|A7NYX8|A7NYX8_VITVI Chromosome chr6 scaffold_3, whole genome ... 57 6e-07
tr|Q1PCS0|Q1PCS0_TOBAC GRAS1 OS=Nicotiana tabacum PE=2 SV=1 53 7e-06
tr|Q00LP5|Q00LP5_SOLLC GRAS4 OS=Solanum lycopersicum GN=GRAS4 PE... 53 9e-06
tr|A7PIT1|A7PIT1_VITVI Chromosome chr13 scaffold_17, whole genom... 52 1e-05
tr|Q2XUT7|Q2XUT7_CAPAN GRAS transcription factor (Fragment) OS=C... 51 3e-05
tr|Q84TZ7|Q84TZ7_ORYSJ Putative uncharacterized protein OSJNBa00... 50 4e-05
tr|Q7X9T5|Q7X9T5_LILLO SCARECROW-like protein OS=Lilium longiflo... 50 4e-05
tr|B8AM74|B8AM74_ORYSI Putative uncharacterized protein OS=Oryza... 50 4e-05
tr|A7PNN8|A7PNN8_VITVI Chromosome chr8 scaffold_23, whole genome... 50 4e-05
tr|A7NYX9|A7NYX9_VITVI Chromosome chr6 scaffold_3, whole genome ... 50 4e-05
tr|A5BUL3|A5BUL3_VITVI Putative uncharacterized protein OS=Vitis... 50 4e-05
tr|A3AK55|A3AK55_ORYSJ Putative uncharacterized protein OS=Oryza... 50 4e-05
tr|A7PIT4|A7PIT4_VITVI Chromosome chr13 scaffold_17, whole genom... 49 2e-04
tr|A7NYY0|A7NYY0_VITVI Chromosome chr6 scaffold_3, whole genome ... 49 2e-04
tr|A5BV87|A5BV87_VITVI Putative uncharacterized protein OS=Vitis... 49 2e-04
tr|Q5N9X3|Q5N9X3_ORYSJ SCARECROW-like protein (Putative uncharac... 47 4e-04
tr|B8AC15|B8AC15_ORYSI Putative uncharacterized protein OS=Oryza... 47 4e-04
tr|A7NYY1|A7NYY1_VITVI Chromosome chr6 scaffold_3, whole genome ... 47 4e-04
tr|Q3EAP0|Q3EAP0_ARATH Uncharacterized protein At3g46600.2 OS=Ar... 47 5e-04
tr|A8MS63|A8MS63_ARATH Uncharacterized protein At3g46600.3 OS=Ar... 47 5e-04
tr|B7ZYK9|B7ZYK9_MAIZE Putative uncharacterized protein OS=Zea m... 46 8e-04
tr|B6U6Z6|B6U6Z6_MAIZE SCARECROW-like protein OS=Zea mays PE=2 SV=1 46 8e-04
tr|A7PIT0|A7PIT0_VITVI Chromosome chr13 scaffold_17, whole genom... 46 0.001
tr|A5BUL4|A5BUL4_VITVI Putative uncharacterized protein OS=Vitis... 46 0.001
tr|Q94HJ3|Q94HJ3_ORYSA Putative SCARECROW gene regulator OS=Oryz... 45 0.002
tr|Q65XW3|Q65XW3_ORYSJ Putative scarecrow gene regulator (Putati... 45 0.002
tr|A7PIS9|A7PIS9_VITVI Chromosome chr13 scaffold_17, whole genom... 45 0.002
tr|A5BUL5|A5BUL5_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|Q7XLZ1|Q7XLZ1_ORYSJ Os04g0590400 protein OS=Oryza sativa subs... 45 0.002

>tr|A3E2G2|A3E2G2_PINRA SCARECROW-like protein 1 OS=Pinus radiata
GN=SCL1 PE=2 SV=1
Length = 810

Score = 58.2 bits (139), Expect = 2e-07
Identities = 24/46 (52%), Positives = 33/46 (71%)
Frame = -2

Query: 403 RKALNESQTIVRCGYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKPA 266
R L++S+ V+ Y K+F VDEDG+WMLL WKG+ H LS W+P+
Sbjct: 764 RSILSKSRDKVKTFYHKDFGVDEDGNWMLLGWKGRTIHALSTWRPS 809


>tr|A7NYX8|A7NYX8_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00024293001
PE=4 SV=1
Length = 442

Score = 56.6 bits (135), Expect = 6e-07
Identities = 23/45 (51%), Positives = 31/45 (68%)
Frame = -2

Query: 403 RKALNESQTIVRCGYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKP 269
++ L+ +T V+ G+ KNF V+EDG WML WKG+ H LS WKP
Sbjct: 397 QEILSRVRTTVKQGFHKNFMVEEDGGWMLQGWKGRTIHALSCWKP 441


>tr|Q1PCS0|Q1PCS0_TOBAC GRAS1 OS=Nicotiana tabacum PE=2 SV=1
Length = 644

Score = 53.1 bits (126), Expect = 7e-06
Identities = 23/36 (63%), Positives = 26/36 (72%)
Frame = -2

Query: 373 VRCGYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKPA 266
VR Y K+FSVDED WML WKG+V + LS WKPA
Sbjct: 606 VRREYHKDFSVDEDSQWMLQGWKGRVVYALSCWKPA 641


>tr|Q00LP5|Q00LP5_SOLLC GRAS4 OS=Solanum lycopersicum GN=GRAS4 PE=2
SV=1
Length = 666

Score = 52.8 bits (125), Expect = 9e-06
Identities = 22/35 (62%), Positives = 26/35 (74%)
Frame = -2

Query: 373 VRCGYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKP 269
VR Y ++FSVDEDG WML WKG+V + LS WKP
Sbjct: 624 VRSEYHRDFSVDEDGHWMLQGWKGRVIYALSCWKP 658


>tr|A7PIT1|A7PIT1_VITVI Chromosome chr13 scaffold_17, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00018463001
PE=4 SV=1
Length = 716

Score = 52.4 bits (124), Expect = 1e-05
Identities = 20/46 (43%), Positives = 31/46 (67%)
Frame = -2

Query: 403 RKALNESQTIVRCGYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKPA 266
R+ + E++ V+ K+F +DEDG W+ L WKG++ H +S WKPA
Sbjct: 670 REVVEEAKEWVKSCLHKDFIIDEDGQWLRLGWKGRITHAMSSWKPA 715


>tr|Q2XUT7|Q2XUT7_CAPAN GRAS transcription factor (Fragment)
OS=Capsicum annuum PE=2 SV=1
Length = 325

Score = 50.8 bits (120), Expect = 3e-05
Identities = 22/35 (62%), Positives = 25/35 (71%)
Frame = -2

Query: 373 VRCGYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKP 269
VR Y K+FSV EDG WML WKG+V + LS WKP
Sbjct: 285 VRSEYHKDFSVHEDGRWMLQGWKGRVFYALSCWKP 319


>tr|Q84TZ7|Q84TZ7_ORYSJ Putative uncharacterized protein
OSJNBa0087M10.10 OS=Oryza sativa subsp. japonica
GN=OSJNBa0087M10.10 PE=4 SV=1
Length = 663

Score = 50.4 bits (119), Expect = 4e-05
Identities = 19/42 (45%), Positives = 30/42 (71%)
Frame = -2

Query: 394 LNESQTIVRCGYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKP 269
+ E+Q +VR GY K+F VDE+ W++L WKG++ + S W+P
Sbjct: 396 VRETQDMVRKGYHKDFLVDEEDQWLVLGWKGRILYASSTWQP 437


>tr|Q7X9T5|Q7X9T5_LILLO SCARECROW-like protein OS=Lilium longiflorum
GN=LlSCL PE=2 SV=1
Length = 748

Score = 50.4 bits (119), Expect = 4e-05
Identities = 22/48 (45%), Positives = 31/48 (64%)
Frame = -2

Query: 403 RKALNESQTIVRCGYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKPAGR 260
R + +S+ V+ Y K+F VDEDG W+LL WKG++ + LS W P R
Sbjct: 701 RDIVKKSKCKVKELYHKDFVVDEDGRWLLLGWKGRIIYALSAWTPNSR 748


>tr|B8AM74|B8AM74_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_12502 PE=4 SV=1
Length = 705

Score = 50.4 bits (119), Expect = 4e-05
Identities = 19/42 (45%), Positives = 30/42 (71%)
Frame = -2

Query: 394 LNESQTIVRCGYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKP 269
+ E+Q +VR GY K+F VDE+ W++L WKG++ + S W+P
Sbjct: 657 VRETQDMVRKGYHKDFLVDEEDQWLVLGWKGRILYASSTWQP 698


>tr|A7PNN8|A7PNN8_VITVI Chromosome chr8 scaffold_23, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021332001
PE=4 SV=1
Length = 743

Score = 50.4 bits (119), Expect = 4e-05
Identities = 20/46 (43%), Positives = 28/46 (60%)
Frame = -2

Query: 403 RKALNESQTIVRCGYSKNFSVDEDGSWMLLCWKGKVAHGLSLWKPA 266
R+ + + V Y K+F +DED WML WKG++ + LS WKPA
Sbjct: 698 RETMKRATERVTTNYHKDFVIDEDSQWMLQGWKGRIIYALSAWKPA 743