BP916893
Clone id YMU001_000093_C09
Library
Length 539
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000093_C09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGGAGACCCAAGAAGGAATGCAATGGCTGGCAGGTGGCTTGAAGCAAGGATCACAATCTT
TGGTATCCGCAGGCCTGGGTAAGTTTCACAAACATTCACACGCCAGGAGTTAGCAGGGAT
GAAGGCAATTACCAACAGGCTGGTGGAAGGCTACAAGGTGTTTGATACAGGGGATAAGGT
GAGTCGCCACGTATGGGCGAAGGGGATGATCTGGCTAATATCTATCAGTTGCAGCTGGAG
TTGCCTTATGATGATGTTTCGAATGAGTGTACACAATTTGGAACACTCTTACATCCAAGC
GGTTTTTCAGAAGGGGGGAGTGACAATAATCACTCCTTTCAAATGTTGGTGTGCGTGTGT
GCACACACGGTTGGCATGAGAAAATACATTCCCATCATACTTGGGCCTAAAGTAACATGT
GTGTTTCATGGTTTGTCCATTTACCTTCGATGGCACACCATTTAGGTTGTCTATATACGG
TGGTGAGCGTTGCTTCGTTTCCAACAATTTTGTCAGAAGAGGGGGAACTGTGAGCACTT
■■Homology search results ■■ -
sp_hit_id Q7SXZ1
Definition sp|Q7SXZ1|PIGB_DANRE GPI mannosyltransferase 3 OS=Danio rerio
Align length 32
Score (bit) 31.2
E-value 3.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916893|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_C09.
(539 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7SXZ1|PIGB_DANRE GPI mannosyltransferase 3 OS=Danio rerio GN... 31 3.4
sp|Q6IR37|ZDH24_MOUSE Probable palmitoyltransferase ZDHHC24 OS=M... 31 4.4

>sp|Q7SXZ1|PIGB_DANRE GPI mannosyltransferase 3 OS=Danio rerio
GN=pigb PE=2 SV=1
Length = 536

Score = 31.2 bits (69), Expect = 3.4
Identities = 12/32 (37%), Positives = 20/32 (62%)
Frame = +1

Query: 388 IPIILGPKVTCVFHGLSIYLRWHTI*VVYIRW 483
+P+++GP + V HG + R HTI ++ I W
Sbjct: 298 LPVVIGPHLPLVLHGCLLSTRKHTILLLTIIW 329


>sp|Q6IR37|ZDH24_MOUSE Probable palmitoyltransferase ZDHHC24 OS=Mus
musculus GN=Zdhhc24 PE=2 SV=2
Length = 284

Score = 30.8 bits (68), Expect = 4.4
Identities = 13/55 (23%), Positives = 32/55 (58%)
Frame = +1

Query: 331 HSFQMLVCVCAHTVGMRKYIPIILGPKVTCVFHGLSIYLRWHTI*VVYIRW*ALL 495
H+++ +C+ H+ G+ +I ++LGP ++ + L + +T+ ++ + W LL
Sbjct: 134 HNYRPFLCLLLHSAGVLLHISVLLGPALSAL---LQAHSALYTVALLLLPWLMLL 185


tr_hit_id B1ZJC2
Definition tr|B1ZJC2|B1ZJC2_METPB Prophage antirepressor OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Align length 32
Score (bit) 33.9
E-value 5.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916893|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_C09.
(539 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B1ZJC2|B1ZJC2_METPB Prophage antirepressor OS=Methylobacteriu... 34 5.6
tr|Q81FF4|Q81FF4_BACCR Flagellar hook-associated protein 1 OS=Ba... 33 7.3
tr|Q53478|Q53478_NEIGO Orf2 protein OS=Neisseria gonorrhoeae GN=... 33 9.5
tr|B6KCM7|B6KCM7_TOXGO Putative uncharacterized protein OS=Toxop... 33 9.5

>tr|B1ZJC2|B1ZJC2_METPB Prophage antirepressor OS=Methylobacterium
populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
GN=Mpop_1864 PE=4 SV=1
Length = 293

Score = 33.9 bits (76), Expect = 5.6
Identities = 14/32 (43%), Positives = 20/32 (62%)
Frame = +2

Query: 431 VCPFTFDGTPFRLSIYGGERCFVSNNFVRRGG 526
+ PF F+GTP R+ GE CFV+++ R G
Sbjct: 21 ITPFDFEGTPVRVVSVDGEPCFVASDLARSLG 52


>tr|Q81FF4|Q81FF4_BACCR Flagellar hook-associated protein 1
OS=Bacillus cereus (strain ATCC 14579 / DSM 31)
GN=BC_1636 PE=4 SV=1
Length = 432

Score = 33.5 bits (75), Expect = 7.3
Identities = 19/66 (28%), Positives = 32/66 (48%)
Frame = +1

Query: 82 SFTNIHTPGVSRDEGNYQQAGGRLQGV*YRG*GESPRMGEGDDLANIYQLQLELPYDDVS 261
+ +NIHTPG R NY+ AGG +G R+G G + ++ E+ +
Sbjct: 26 NLSNIHTPGYVRQMVNYESAGGS------KGYAPEQRIGYGVQTLGVDRITDEVKTKQYN 79

Query: 262 NECTQF 279
++ +QF
Sbjct: 80 DQMSQF 85


>tr|Q53478|Q53478_NEIGO Orf2 protein OS=Neisseria gonorrhoeae
GN=orf2 PE=4 SV=1
Length = 456

Score = 33.1 bits (74), Expect = 9.5
Identities = 13/23 (56%), Positives = 15/23 (65%)
Frame = -1

Query: 212 RSSPSPIRGDSPYPLYQTPCSLP 144
RS P P G P+PL QTPC+ P
Sbjct: 287 RSRPLPAHGGLPFPLVQTPCTRP 309


>tr|B6KCM7|B6KCM7_TOXGO Putative uncharacterized protein OS=Toxoplasma
gondii ME49 GN=TGME49_069070 PE=4 SV=1
Length = 4436

Score = 33.1 bits (74), Expect = 9.5
Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
Frame = -1

Query: 221 ILARSSPSPIRGDSPYPLYQTP-CSLPPACW*LPSSLLTP 105
+L+RSS SP S P CS PPA W +PSS +P
Sbjct: 2636 VLSRSSKSPSSSASAAVRPSAPLCSSPPASWYIPSSCFSP 2675