BP916920
Clone id YMU001_000093_F01
Library
Length 495
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000093_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTGACACATTACTCTGATTAACAAGCTAACCTTTAATGCTAATTAGTATCCCACGTTATC
TAAGCTTAACATTGCCCTATTAGCCTTACAAGTTTGACACATTACTCTAATTGATAAGCT
TTGCTTTCCTGCATTCATTTCTTCTTTTCTTTCAAATCAACACACATTAAGGAAGCTCAA
TTAGTGCACCTTTGCACTTGCGTAATCCGCATTAATTATTATTGATGCTGGCGCCTGCAC
CAGTGGGGATGTGTCGGGTAAGCCAAGATCAGATGGAGAACATGAATGCAGACCAAATTG
ACATTAGCCTAATGCAAAAGGCTGGATCAATTAATAATGGGAGCTCATGTAAAGCAAGTG
GCGATGATCAGATTAATGGGCAAAGAGAAATGAACAAGCAGAACAATTATAAACATAGTA
CTCAAGAGGAGGAGAATCAGCTTCCCGAAGAGCTCAAGAATGTACTTCATCTGTCAGCAT
CTCCCAGCACCCAAC
■■Homology search results ■■ -
sp_hit_id Q54R95
Definition sp|Q54R95|Y3337_DICDI Probable serine/threonine-protein kinase DDB_G0283337 OS=Dictyostelium discoideum
Align length 72
Score (bit) 32.3
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916920|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_F01.
(495 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q54R95|Y3337_DICDI Probable serine/threonine-protein kinase D... 32 1.2
sp|Q089E2|LEXA_SHEFN LexA repressor OS=Shewanella frigidimarina ... 32 1.2
sp|Q04596|LEXA_PECCC LexA repressor OS=Pectobacterium carotovoru... 32 1.2
sp|Q6D9I5|LEXA_ERWCT LexA repressor OS=Erwinia carotovora subsp.... 32 1.2
sp|Q12000|TMA46_YEAST Translation machinery-associated protein 4... 32 1.6
sp|P21147|ACO1_YEAST Acyl-CoA desaturase 1 OS=Saccharomyces cere... 32 1.6
sp|P30199|EPIP_STAEP Epidermin leader peptide-processing serine ... 32 2.1
sp|A9KUW8|LEXA_SHEB9 LexA repressor OS=Shewanella baltica (strai... 31 2.7
sp|A6WU05|LEXA_SHEB8 LexA repressor OS=Shewanella baltica (strai... 31 2.7
sp|A3CYX7|LEXA_SHEB5 LexA repressor OS=Shewanella baltica (strai... 31 2.7
sp|Q0HDL5|LEXA_SHESM LexA repressor OS=Shewanella sp. (strain MR... 31 3.5
sp|A0L2D8|LEXA_SHESA LexA repressor OS=Shewanella sp. (strain AN... 31 3.5
sp|Q55G93|TBCD_DICDI Tubulin-specific chaperone D OS=Dictyosteli... 30 4.6
sp|Q54G05|LRRX1_DICDI Putative leucine-rich repeat-containing pr... 30 4.6
sp|B0TNT3|LEXA_SHEHH LexA repressor OS=Shewanella halifaxensis (... 30 4.6
sp|Q54LK8|Y7027_DICDI Uncharacterized protein DDB_G0286591 OS=Di... 30 6.0
sp|P29469|MCM2_YEAST DNA replication licensing factor MCM2 OS=Sa... 30 6.0
sp|Q0HPW6|LEXA_SHESR LexA repressor OS=Shewanella sp. (strain MR... 30 6.0
sp|Q75JZ0|GTAH_DICDI GATA zinc finger domain-containing protein ... 30 6.0
sp|Q6BHF8|ATG23_DEBHA Autophagy-related protein 23 OS=Debaryomyc... 30 6.0
sp|P08161|VE94_NPVAC Early 94 kDa protein OS=Autographa californ... 30 7.9
sp|Q8A120|MUTL_BACTN DNA mismatch repair protein mutL OS=Bactero... 30 7.9
sp|Q8E8Q8|LEXA_SHEON LexA repressor OS=Shewanella oneidensis GN=... 30 7.9

>sp|Q54R95|Y3337_DICDI Probable serine/threonine-protein kinase
DDB_G0283337 OS=Dictyostelium discoideum GN=DDB_G0283337
PE=3 SV=1
Length = 1128

Score = 32.3 bits (72), Expect = 1.2
Identities = 19/72 (26%), Positives = 30/72 (41%)
Frame = +3

Query: 252 CRVSQDQMENMNADQIDISLMQKAGSINNGSSCKASGDDQINGQREMNKQNNYKHSTQEE 431
C S + +N + DIS SINN + + I E N +NNY +
Sbjct: 242 CNSSNNSYDNDSNSNSDISTSVNCNSINNNDTIDKNNSTNIIKSIENNNKNNY--NKNNN 299

Query: 432 ENQLPEELKNVL 467
+N + +N+L
Sbjct: 300 KNNIKSIFENIL 311


>sp|Q089E2|LEXA_SHEFN LexA repressor OS=Shewanella frigidimarina
(strain NCIMB 400) GN=lexA PE=3 SV=1
Length = 204

Score = 32.3 bits (72), Expect = 1.2
Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
Frame = +3

Query: 234 PAPVGMCRVSQDQMENMNADQIDISLMQKAGSINNGSSCKASGDDQINGQREMNKQN-NY 410
PA + RV D M+N+ + D+ + K NG A DD + +R K N Y
Sbjct: 109 PAADFLLRVRGDSMKNIGILEGDLLAVHKMQQARNGQVVVARVDDDVTVKRFEQKGNVIY 168

Query: 411 KHSTQEEENQLPEEL 455
H+ E+ N + +L
Sbjct: 169 LHAENEDYNPIKVDL 183


>sp|Q04596|LEXA_PECCC LexA repressor OS=Pectobacterium carotovorum
subsp. carotovorum GN=lexA PE=3 SV=1
Length = 202

Score = 32.3 bits (72), Expect = 1.2
Identities = 21/71 (29%), Positives = 32/71 (45%)
Frame = +3

Query: 234 PAPVGMCRVSQDQMENMNADQIDISLMQKAGSINNGSSCKASGDDQINGQREMNKQNNYK 413
P+ + RVS M+N+ D+ + K + NG A DD++ +R + KQ N
Sbjct: 107 PSADFLLRVSGMSMKNIGIMDGDLLAVHKTEDVRNGQIVVARIDDEVTVKR-LKKQGNTV 165

Query: 414 HSTQEEENQLP 446
H E E P
Sbjct: 166 HLLAENEEFAP 176


>sp|Q6D9I5|LEXA_ERWCT LexA repressor OS=Erwinia carotovora subsp.
atroseptica GN=lexA PE=3 SV=1
Length = 202

Score = 32.3 bits (72), Expect = 1.2
Identities = 21/71 (29%), Positives = 32/71 (45%)
Frame = +3

Query: 234 PAPVGMCRVSQDQMENMNADQIDISLMQKAGSINNGSSCKASGDDQINGQREMNKQNNYK 413
P+ + RVS M+N+ D+ + K + NG A DD++ +R + KQ N
Sbjct: 107 PSADFLLRVSGMSMKNIGIMDGDLLAVHKTEDVRNGQIVVARIDDEVTVKR-LKKQGNTV 165

Query: 414 HSTQEEENQLP 446
H E E P
Sbjct: 166 HLLAENEEFAP 176


>sp|Q12000|TMA46_YEAST Translation machinery-associated protein 46
OS=Saccharomyces cerevisiae GN=TMA46 PE=1 SV=2
Length = 345

Score = 32.0 bits (71), Expect = 1.6
Identities = 16/40 (40%), Positives = 24/40 (60%)
Frame = +3

Query: 318 KAGSINNGSSCKASGDDQINGQREMNKQNNYKHSTQEEEN 437
K G+ N G+ CK S D +N R M K++ Y+ + E+EN
Sbjct: 97 KLGNCNKGAKCKFSHD--LNVGRRMEKKDLYQDTRSEKEN 134


>sp|P21147|ACO1_YEAST Acyl-CoA desaturase 1 OS=Saccharomyces
cerevisiae GN=OLE1 PE=1 SV=2
Length = 510

Score = 32.0 bits (71), Expect = 1.6
Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 4/79 (5%)
Frame = +3

Query: 267 DQMENMNADQIDISLMQKAGSINNGSSCKASGDDQINGQREMNKQNNYKHSTQ----EEE 434
D+++ A+ + L +KA I NG + ++ E +K+ N K S E++
Sbjct: 27 DEVDLTEANILATGLNKKAPRIVNGFGSLMGSKEMVSV--EFDKKGNEKKSNLDRLLEKD 84

Query: 435 NQLPEELKNVLHLSASPST 491
NQ EE K +H+S P T
Sbjct: 85 NQEKEEAKTKIHISEQPWT 103


>sp|P30199|EPIP_STAEP Epidermin leader peptide-processing serine
protease epiP OS=Staphylococcus epidermidis GN=epiP PE=3
SV=1
Length = 461

Score = 31.6 bits (70), Expect = 2.1
Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 2/73 (2%)
Frame = +3

Query: 255 RVSQDQMENMNADQIDISLMQKAGSINNGSSCKASGDDQINGQR--EMNKQNNYKHSTQE 428
++ D+ + +A Q I+ QK GSI A G+D IN ++ E+NK+ N T +
Sbjct: 265 KLRDDEKVDYDALQKAINYAQKKGSI----VVAAVGNDGINVKKVKEINKKRNLNSKTSK 320

Query: 429 EENQLPEELKNVL 467
+ P L NV+
Sbjct: 321 KVYDSPANLNNVM 333


>sp|A9KUW8|LEXA_SHEB9 LexA repressor OS=Shewanella baltica (strain
OS195) GN=lexA PE=3 SV=1
Length = 206

Score = 31.2 bits (69), Expect = 2.7
Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
Frame = +3

Query: 234 PAPVGMCRVSQDQMENMNADQIDISLMQKAGSINNGSSCKASGDDQINGQREMNKQN-NY 410
PA + RV D M+N+ + D+ + K NG A DD + +R K N Y
Sbjct: 111 PAADFLLRVKGDSMKNIGILEGDLLAVHKVQQARNGQVVVARVDDDVTVKRFEKKGNVVY 170

Query: 411 KHSTQEEENQLPEEL 455
H+ E+ + + +L
Sbjct: 171 LHAENEDYSPIKVDL 185


>sp|A6WU05|LEXA_SHEB8 LexA repressor OS=Shewanella baltica (strain
OS185) GN=lexA PE=3 SV=1
Length = 206

Score = 31.2 bits (69), Expect = 2.7
Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
Frame = +3

Query: 234 PAPVGMCRVSQDQMENMNADQIDISLMQKAGSINNGSSCKASGDDQINGQREMNKQN-NY 410
PA + RV D M+N+ + D+ + K NG A DD + +R K N Y
Sbjct: 111 PAADFLLRVKGDSMKNIGILEGDLLAVHKVQQARNGQVVVARVDDDVTVKRFEKKGNVVY 170

Query: 411 KHSTQEEENQLPEEL 455
H+ E+ + + +L
Sbjct: 171 LHAENEDYSPIKVDL 185


>sp|A3CYX7|LEXA_SHEB5 LexA repressor OS=Shewanella baltica (strain
OS155 / ATCC BAA-1091) GN=lexA PE=3 SV=1
Length = 206

Score = 31.2 bits (69), Expect = 2.7
Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
Frame = +3

Query: 234 PAPVGMCRVSQDQMENMNADQIDISLMQKAGSINNGSSCKASGDDQINGQREMNKQN-NY 410
PA + RV D M+N+ + D+ + K NG A DD + +R K N Y
Sbjct: 111 PAADFLLRVKGDSMKNIGILEGDLLAVHKVQQARNGQVVVARVDDDVTVKRFEKKGNVVY 170

Query: 411 KHSTQEEENQLPEEL 455
H+ E+ + + +L
Sbjct: 171 LHAENEDYSPIKVDL 185


tr_hit_id B6NF61
Definition tr|B6NF61|B6NF61_BRAFL Putative uncharacterized protein OS=Branchiostoma floridae
Align length 83
Score (bit) 35.8
E-value 1.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916920|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_F01.
(495 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6NF61|B6NF61_BRAFL Putative uncharacterized protein OS=Branc... 36 1.1
tr|B4LX47|B4LX47_DROVI GJ23484 OS=Drosophila virilis GN=GJ23484 ... 35 2.5
tr|A2EWW4|A2EWW4_TRIVA Putative uncharacterized protein OS=Trich... 35 2.5
tr|A5K7E7|A5K7E7_PLAVI Putative uncharacterized protein OS=Plasm... 34 3.3
tr|Q23RE0|Q23RE0_TETTH MT-A70 family protein OS=Tetrahymena ther... 34 4.3
tr|Q23E97|Q23E97_TETTH Putative uncharacterized protein OS=Tetra... 34 4.3
tr|Q23DV8|Q23DV8_TETTH Putative uncharacterized protein OS=Tetra... 34 4.3
tr|Q238S4|Q238S4_TETTH Ubiquitin carboxyl-terminal hydrolase fam... 34 4.3
tr|Q22TZ6|Q22TZ6_TETTH Putative uncharacterized protein OS=Tetra... 33 5.6
tr|Q22LM9|Q22LM9_TETTH Putative uncharacterized protein OS=Tetra... 33 5.6
tr|B0S1M4|B0S1M4_FINM2 Chromosome segregation SMC protein OS=Fin... 33 7.3
tr|Q7RB20|Q7RB20_PLAYO Putative uncharacterized protein PY06328 ... 33 7.3
tr|Q24FB9|Q24FB9_TETTH Putative uncharacterized protein OS=Tetra... 33 7.3
tr|Q23FX1|Q23FX1_TETTH Putative uncharacterized protein OS=Tetra... 33 7.3
tr|Q1PHR0|Q1PHR0_SACKO Tbx2/3 OS=Saccoglossus kowalevskii PE=2 SV=1 33 7.3
tr|A5DS35|A5DS35_LODEL Putative uncharacterized protein OS=Lodde... 33 7.3
tr|Q043H2|Q043H2_LACGA Membrane carboxypeptidase (Penicillin-bin... 33 9.5
tr|Q24FU5|Q24FU5_TETTH Putative uncharacterized protein OS=Tetra... 33 9.5
tr|A2EYA1|A2EYA1_TRIVA Viral A-type inclusion protein, putative ... 33 9.5
tr|A0D905|A0D905_PARTE Chromosome undetermined scaffold_41, whol... 33 9.5
tr|A0C1A9|A0C1A9_PARTE Chromosome undetermined scaffold_141, who... 33 9.5

>tr|B6NF61|B6NF61_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_94398 PE=4 SV=1
Length = 993

Score = 35.8 bits (81), Expect = 1.1
Identities = 20/83 (24%), Positives = 42/83 (50%)
Frame = +3

Query: 246 GMCRVSQDQMENMNADQIDISLMQKAGSINNGSSCKASGDDQINGQREMNKQNNYKHSTQ 425
GM +++ + NAD+IDIS + GS + + Q+ Q++ +K ++ + Q
Sbjct: 853 GMLAMAKQWKKQRNADEIDISGSDEEGSEGGEDESRGNTTKQLRKQKDPDKDSSSEEEAQ 912

Query: 426 EEENQLPEELKNVLHLSASPSTQ 494
E + + E ++ S+S S++
Sbjct: 913 ERKKEGRAEREDSSDSSSSSSSE 935


>tr|B4LX47|B4LX47_DROVI GJ23484 OS=Drosophila virilis GN=GJ23484 PE=4
SV=1
Length = 1827

Score = 34.7 bits (78), Expect = 2.5
Identities = 19/62 (30%), Positives = 29/62 (46%)
Frame = +3

Query: 309 LMQKAGSINNGSSCKASGDDQINGQREMNKQNNYKHSTQEEENQLPEELKNVLHLSASPS 488
L Q A +N G + K S ING ++ + + E+EN+L E + H A+P
Sbjct: 1706 LAQSAAPLNGGKNAKKSVAPHINGAQDDGYDDGIDYEPDEDENELLLEEDDDYHYLAAPD 1765

Query: 489 TQ 494
Q
Sbjct: 1766 DQ 1767


>tr|A2EWW4|A2EWW4_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_174210 PE=4 SV=1
Length = 1102

Score = 34.7 bits (78), Expect = 2.5
Identities = 20/69 (28%), Positives = 31/69 (44%)
Frame = +3

Query: 255 RVSQDQMENMNADQIDISLMQKAGSINNGSSCKASGDDQINGQREMNKQNNYKHSTQEEE 434
+V + E++ DQ +L + + N S D N QRE N +N ++ E +
Sbjct: 809 QVETNSEEDLQNDQFPQNLGESRNNSNIDPDHHESEDQSENSQREENNENQMQNQNPEPQ 868

Query: 435 NQLPEELKN 461
NQ EE N
Sbjct: 869 NQNHEEQNN 877


>tr|A5K7E7|A5K7E7_PLAVI Putative uncharacterized protein
OS=Plasmodium vivax GN=PVX_094830 PE=4 SV=1
Length = 250

Score = 34.3 bits (77), Expect = 3.3
Identities = 14/66 (21%), Positives = 36/66 (54%)
Frame = +3

Query: 255 RVSQDQMENMNADQIDISLMQKAGSINNGSSCKASGDDQINGQREMNKQNNYKHSTQEEE 434
+++ D +++ + + + +KA + N+ ++ K G++ NG + N++N + + EE
Sbjct: 41 KLNNDDVDHYSFLSLRTANEEKAATENDSNNAKKEGEENTNGNEKKNEENGSGNEKRNEE 100

Query: 435 NQLPEE 452
N E+
Sbjct: 101 NNANEK 106


>tr|Q23RE0|Q23RE0_TETTH MT-A70 family protein OS=Tetrahymena
thermophila SB210 GN=TTHERM_00388490 PE=4 SV=1
Length = 2070

Score = 33.9 bits (76), Expect = 4.3
Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
Frame = +3

Query: 264 QDQMENMNADQIDISLMQKAGSINN-GSSCKASGDDQINGQREMNKQNNYKHSTQEEENQ 440
+DQ E + D + +K+ SINN S S +Q+ + + +++N K+ +EEN+
Sbjct: 1729 EDQSEEKKEENNDQLIDKKSDSINNENKSVDESKQNQMEEEEDQKEESN-KNEDDKEENE 1787

Query: 441 LPEELKNV 464
+ EE K V
Sbjct: 1788 IQEENKVV 1795


>tr|Q23E97|Q23E97_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00717820 PE=4
SV=1
Length = 1548

Score = 33.9 bits (76), Expect = 4.3
Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 5/70 (7%)
Frame = +3

Query: 255 RVSQDQMEN-MNADQIDISLMQKAGSINNGSSCKASGDD-QINGQREMNKQNNYKHSTQE 428
++ Q Q++ M Q ++ ++ IN KA ++ QI G +E KQN Y TQ+
Sbjct: 579 QIQQQQLDKKMQQQQQELQKQLQSNQINQQKLIKAEQNNIQIGGLQETGKQNQYIQDTQD 638

Query: 429 E---ENQLPE 449
E +NQ+ E
Sbjct: 639 ESQTQNQIEE 648


>tr|Q23DV8|Q23DV8_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00043850 PE=4
SV=2
Length = 3106

Score = 33.9 bits (76), Expect = 4.3
Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%)
Frame = +3

Query: 294 QIDISLMQKAGSINNGSSC--KASGDDQINGQREMNKQNNYKHSTQEEENQ 440
Q+ I L Q+ S+NNGS+C + S + QI Q+ + + NYK ++ + Q
Sbjct: 1132 QMQIQLQQQYQSVNNGSACNNQQSNNSQITQQKTYSPRVNYKIISENIKKQ 1182


>tr|Q238S4|Q238S4_TETTH Ubiquitin carboxyl-terminal hydrolase family
protein OS=Tetrahymena thermophila SB210
GN=TTHERM_00450950 PE=4 SV=1
Length = 2516

Score = 33.9 bits (76), Expect = 4.3
Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
Frame = +3

Query: 315 QKAGSINNGSSCKASGDDQINGQREMNKQNN---YKHSTQEEENQLPEELKNVLH 470
QK N SS S D+ N ++ +K NN K + +EEEN+LP K +H
Sbjct: 1567 QKTHVNQNQSSNSVSNTDKNNNNQDQSKNNNETFLKQNRKEEENKLPLIQKKTVH 1621


>tr|Q22TZ6|Q22TZ6_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00264860 PE=4
SV=1
Length = 240

Score = 33.5 bits (75), Expect = 5.6
Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 4/73 (5%)
Frame = +3

Query: 252 CRVSQDQMENMNADQIDISLMQKAGSINNG----SSCKASGDDQINGQREMNKQNNYKHS 419
C S + +EN ++ + SL Q A S + +SCK IN Q E N N +
Sbjct: 62 CNYSLENIENQSSSLNNSSLDQSADSSSENYESDNSCKHDSTSSINNQIEENIACNQINI 121

Query: 420 TQEEENQLPEELK 458
QEEE Q +K
Sbjct: 122 LQEEEYQQNAPIK 134


>tr|Q22LM9|Q22LM9_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00701200 PE=4
SV=1
Length = 1552

Score = 33.5 bits (75), Expect = 5.6
Identities = 18/77 (23%), Positives = 36/77 (46%), Gaps = 3/77 (3%)
Frame = +3

Query: 261 SQDQMENMNADQIDISLMQKAGSINNGSSCKASGDDQ---INGQREMNKQNNYKHSTQEE 431
SQ Q+ N + S Q +N+ +S ++G +N + +Q STQ
Sbjct: 326 SQHQILNQQQSSQNPSQQQNLAGVNSQNSASSTGSSTSQTLNNSQNQGQQGQQAQSTQNN 385

Query: 432 ENQLPEELKNVLHLSAS 482
+ L ++ KN+L+++ +
Sbjct: 386 SSSLQQQNKNLLNVNGN 402