BP916924
Clone id YMU001_000093_F05
Library
Length 610
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000093_F05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTGTTGTCGAGCGACGGTCGAGGAGTATGGAGCATTATGTAAGGCAGACGCCGCGGTGCG
AATCAATATGCAAGCCAGGACGATTCTTGCCAGGCTTGCTCGACATCACAAACAATCGCC
CATATTATCTGCAAGCAGAATTGTCTCCTCGTCCTGGGCATACGTTCGTCAAAGCCCATT
TGCGGAGGGGCCTTCAGATCACACCATTTTCCATTATTCGAGCAAAGCAGTGAAGGGGCG
GGAGACAGAGATAGTTGTCAAACAACCCGCTATTTCTGTTGAAGATGCTGCTAAGGCCAA
AGGAGTTGAAATTTCAACAAGGCCCCGTGAGATGACAGCAGACTCATGTAGAACAGGTGC
CATTGCCATCAAATGTGGCATGACGGCAGGGTGGGACAAGTGGGGGGCACGTGTTCCCTA
CACTGTTCTCTGGTTTGATCACAATGTTGTCACACAAGTGAAAGTTGAAGGAAAGGATTG
CACCACTGCGCTCCAGGTGGGGTGTGGGCTAAAGAAAGCCAAGCAACTAACCAAGCCTGA
GGTTGGCCACTTCATCAAGCAAGGAGTCCCTCTCAAGCGCAAGCTGACTGAGTTCCAGTC
ACAGATGATG
■■Homology search results ■■ -
sp_hit_id Q9LRN8
Definition sp|Q9LRN8|RK3B_ARATH 50S ribosomal protein L3-2, chloroplastic OS=Arabidopsis thaliana
Align length 95
Score (bit) 120.0
E-value 5.0e-27
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916924|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_F05.
(610 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LRN8|RK3B_ARATH 50S ribosomal protein L3-2, chloroplastic O... 120 5e-27
sp|B0UX13|RL3_HAES2 50S ribosomal protein L3 OS=Haemophilus somn... 72 2e-12
sp|Q0I163|RL3_HAES1 50S ribosomal protein L3 OS=Haemophilus somn... 72 2e-12
sp|P44344|RL3_HAEIN 50S ribosomal protein L3 OS=Haemophilus infl... 72 2e-12
sp|A5UHT0|RL3_HAEIG 50S ribosomal protein L3 OS=Haemophilus infl... 72 2e-12
sp|Q4QMC2|RL3_HAEI8 50S ribosomal protein L3 OS=Haemophilus infl... 72 2e-12
sp|Q7VKD2|RL3_HAEDU 50S ribosomal protein L3 OS=Haemophilus ducr... 72 3e-12
sp|Q9A8V3|RL3_CAUCR 50S ribosomal protein L3 OS=Caulobacter cres... 72 3e-12
sp|A6VLI8|RL3_ACTSZ 50S ribosomal protein L3 OS=Actinobacillus s... 71 4e-12
sp|Q6A6M6|RL3_PROAC 50S ribosomal protein L3 OS=Propionibacteriu... 70 7e-12
sp|A3N358|RL3_ACTP2 50S ribosomal protein L3 OS=Actinobacillus p... 70 8e-12
sp|Q9CL32|RL3_PASMU 50S ribosomal protein L3 OS=Pasteurella mult... 70 1e-11
sp|Q65QV5|RL3_MANSM 50S ribosomal protein L3 OS=Mannheimia succi... 70 1e-11
sp|Q9ZI50|RL3_AQUPY 50S ribosomal protein L3 OS=Aquifex pyrophil... 69 1e-11
sp|A9WSV9|RL3_RENSM 50S ribosomal protein L3 OS=Renibacterium sa... 69 2e-11
sp|Q5NQ64|RL3_ZYMMO 50S ribosomal protein L3 OS=Zymomonas mobili... 68 3e-11
sp|O66431|RL3_AQUAE 50S ribosomal protein L3 OS=Aquifex aeolicus... 68 3e-11
sp|A1KRH3|RL3_NEIMF 50S ribosomal protein L3 OS=Neisseria mening... 67 6e-11
sp|P60444|RL3_NEIMB 50S ribosomal protein L3 OS=Neisseria mening... 67 6e-11
sp|P60443|RL3_NEIMA 50S ribosomal protein L3 OS=Neisseria mening... 67 6e-11
sp|A9M3W6|RL3_NEIM0 50S ribosomal protein L3 OS=Neisseria mening... 67 6e-11
sp|Q5F5S7|RL3_NEIG1 50S ribosomal protein L3 OS=Neisseria gonorr... 67 6e-11
sp|B0T2C2|RL3_CAUSK 50S ribosomal protein L3 OS=Caulobacter sp. ... 67 6e-11
sp|A9H3R5|RL3_GLUDA 50S ribosomal protein L3 OS=Gluconacetobacte... 67 7e-11
sp|Q6CZX0|RL3_ERWCT 50S ribosomal protein L3 OS=Erwinia carotovo... 67 7e-11
sp|Q3YWT9|RL3_SHISS 50S ribosomal protein L3 OS=Shigella sonnei ... 66 1e-10
sp|Q2S3R4|RL3_SALRD 50S ribosomal protein L3 OS=Salinibacter rub... 66 1e-10
sp|A9MN46|RL3_SALAR 50S ribosomal protein L3 OS=Salmonella arizo... 66 1e-10
sp|A1SNL8|RL3_NOCSJ 50S ribosomal protein L3 OS=Nocardioides sp.... 66 1e-10
sp|Q89A68|RL3_BUCBP 50S ribosomal protein L3 OS=Buchnera aphidic... 66 1e-10

>sp|Q9LRN8|RK3B_ARATH 50S ribosomal protein L3-2, chloroplastic
OS=Arabidopsis thaliana GN=RPL3B PE=2 SV=1
Length = 324

Score = 120 bits (301), Expect = 5e-27
Identities = 57/95 (60%), Positives = 69/95 (72%)
Frame = +2

Query: 311 ISTRPREMTADSCRTGAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTA 490
I + EM++ S RTG IA+KCGMTA WDKWG R+P ++LW D N+V+QVK K+ A
Sbjct: 63 IEAKQGEMSSRSKRTGIIAVKCGMTALWDKWGKRIPISILWVDDNIVSQVKTVEKEGIFA 122

Query: 491 LQVGCGLKKAKQLTKPEVGHFIKQGVPLKRKLTEF 595
LQ+GCG KK K L+K VGHF QGVPLKRKL EF
Sbjct: 123 LQIGCGQKKPKHLSKAVVGHFRAQGVPLKRKLREF 157


>sp|B0UX13|RL3_HAES2 50S ribosomal protein L3 OS=Haemophilus somnus
(strain 2336) GN=rplC PE=3 SV=1
Length = 208

Score = 72.4 bits (176), Expect = 2e-12
Identities = 38/83 (45%), Positives = 52/83 (62%)
Frame = +2

Query: 356 GAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTALQVGCGLKKAKQLTK 535
G + K GMT +++ G +P TV+ + N VTQVK D TA+QV G KKA ++TK
Sbjct: 3 GLVGRKVGMTRIFNEDGVSIPVTVIEIEANRVTQVKTLENDGYTAVQVTTGFKKASRVTK 62

Query: 536 PEVGHFIKQGVPLKRKLTEFQSQ 604
PE GHF+K GV R L EF+++
Sbjct: 63 PEAGHFVKAGVEAGRGLWEFRTE 85


>sp|Q0I163|RL3_HAES1 50S ribosomal protein L3 OS=Haemophilus somnus
(strain 129Pt) GN=rplC PE=3 SV=1
Length = 208

Score = 72.4 bits (176), Expect = 2e-12
Identities = 38/83 (45%), Positives = 52/83 (62%)
Frame = +2

Query: 356 GAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTALQVGCGLKKAKQLTK 535
G + K GMT +++ G +P TV+ + N VTQVK D TA+QV G KKA ++TK
Sbjct: 3 GLVGRKVGMTRIFNEDGVSIPVTVIEIEANRVTQVKTLENDGYTAVQVTTGFKKASRVTK 62

Query: 536 PEVGHFIKQGVPLKRKLTEFQSQ 604
PE GHF+K GV R L EF+++
Sbjct: 63 PEAGHFVKAGVEAGRGLWEFRTE 85


>sp|P44344|RL3_HAEIN 50S ribosomal protein L3 OS=Haemophilus
influenzae GN=rplC PE=3 SV=1
Length = 208

Score = 72.0 bits (175), Expect = 2e-12
Identities = 39/83 (46%), Positives = 52/83 (62%)
Frame = +2

Query: 356 GAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTALQVGCGLKKAKQLTK 535
G + K GMT +++ G VP TV+ + N VTQVK D TA+QV G KKA ++TK
Sbjct: 3 GLVGRKVGMTRIFNEDGVSVPVTVIEIEANRVTQVKTLENDGYTAVQVTTGSKKANRVTK 62

Query: 536 PEVGHFIKQGVPLKRKLTEFQSQ 604
PE GHF+K GV R L EF+++
Sbjct: 63 PEAGHFVKAGVEAGRGLWEFRTE 85


>sp|A5UHT0|RL3_HAEIG 50S ribosomal protein L3 OS=Haemophilus
influenzae (strain PittGG) GN=rplC PE=3 SV=1
Length = 208

Score = 72.0 bits (175), Expect = 2e-12
Identities = 39/83 (46%), Positives = 52/83 (62%)
Frame = +2

Query: 356 GAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTALQVGCGLKKAKQLTK 535
G + K GMT +++ G VP TV+ + N VTQVK D TA+QV G KKA ++TK
Sbjct: 3 GLVGRKVGMTRIFNEDGVSVPVTVIEIEANRVTQVKTLENDGYTAVQVTTGSKKANRVTK 62

Query: 536 PEVGHFIKQGVPLKRKLTEFQSQ 604
PE GHF+K GV R L EF+++
Sbjct: 63 PEAGHFVKAGVEAGRGLWEFRTE 85


>sp|Q4QMC2|RL3_HAEI8 50S ribosomal protein L3 OS=Haemophilus
influenzae (strain 86-028NP) GN=rplC PE=3 SV=1
Length = 208

Score = 72.0 bits (175), Expect = 2e-12
Identities = 39/83 (46%), Positives = 52/83 (62%)
Frame = +2

Query: 356 GAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTALQVGCGLKKAKQLTK 535
G + K GMT +++ G VP TV+ + N VTQVK D TA+QV G KKA ++TK
Sbjct: 3 GLVGRKVGMTRIFNEDGVSVPVTVIEIEANRVTQVKTLENDGYTAVQVTTGSKKANRVTK 62

Query: 536 PEVGHFIKQGVPLKRKLTEFQSQ 604
PE GHF+K GV R L EF+++
Sbjct: 63 PEAGHFVKAGVEAGRGLWEFRTE 85


>sp|Q7VKD2|RL3_HAEDU 50S ribosomal protein L3 OS=Haemophilus ducreyi
GN=rplC PE=3 SV=1
Length = 208

Score = 71.6 bits (174), Expect = 3e-12
Identities = 38/83 (45%), Positives = 52/83 (62%)
Frame = +2

Query: 356 GAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTALQVGCGLKKAKQLTK 535
G I K GMT +++ G +P TV+ + N VTQVK D +A+QV G KKA ++TK
Sbjct: 3 GLIGRKVGMTRVFNEDGVSIPVTVIEIEANRVTQVKTLENDGYSAIQVTTGTKKASRVTK 62

Query: 536 PEVGHFIKQGVPLKRKLTEFQSQ 604
PE GHF+K GV R L EF+++
Sbjct: 63 PEAGHFVKAGVEAGRGLWEFRTE 85


>sp|Q9A8V3|RL3_CAUCR 50S ribosomal protein L3 OS=Caulobacter
crescentus GN=rplC PE=3 SV=2
Length = 255

Score = 71.6 bits (174), Expect = 3e-12
Identities = 43/89 (48%), Positives = 51/89 (57%)
Frame = +2

Query: 332 MTADSCRTGAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTALQVGCGL 511
MT + RTG IA K GMT +D+ G VP TVL D VT V+ KD TALQ+G G
Sbjct: 1 MTLPTQRTGVIAKKLGMTRFFDEAGQHVPVTVLSLDGCQVTGVRTVEKDGYTALQLGAGA 60

Query: 512 KKAKQLTKPEVGHFIKQGVPLKRKLTEFQ 598
KKAK + GHF K V KR + EF+
Sbjct: 61 KKAKNTSNAMRGHFAKAAVEPKRVVAEFR 89


>sp|A6VLI8|RL3_ACTSZ 50S ribosomal protein L3 OS=Actinobacillus
succinogenes (strain ATCC 55618 / 130Z) GN=rplC PE=3
SV=1
Length = 208

Score = 71.2 bits (173), Expect = 4e-12
Identities = 38/83 (45%), Positives = 51/83 (61%)
Frame = +2

Query: 356 GAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTALQVGCGLKKAKQLTK 535
G + K GMT + + G +P TV+ + N VTQVK D TA+QV G KKA ++TK
Sbjct: 3 GLVGRKVGMTRVFTEDGVSIPVTVIEIEANRVTQVKTLENDGYTAVQVTTGSKKASRVTK 62

Query: 536 PEVGHFIKQGVPLKRKLTEFQSQ 604
PE GHF+K GV R L EF+++
Sbjct: 63 PEAGHFVKAGVEAGRGLWEFRTE 85


>sp|Q6A6M6|RL3_PROAC 50S ribosomal protein L3 OS=Propionibacterium
acnes GN=rplC PE=3 SV=1
Length = 223

Score = 70.5 bits (171), Expect = 7e-12
Identities = 39/90 (43%), Positives = 51/90 (56%)
Frame = +2

Query: 332 MTADSCRTGAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTALQVGCGL 511
MT + G + K GMT WD+ VP TV+ VVTQV+ D +A+Q+G G
Sbjct: 1 MTNERTVKGVLGTKLGMTQLWDEHNRLVPVTVIQAGPCVVTQVRTPETDGYSAVQLGYGA 60

Query: 512 KKAKQLTKPEVGHFIKQGVPLKRKLTEFQS 601
KAK +TKPE GHF K GV +R L E ++
Sbjct: 61 VKAKNVTKPEAGHFEKAGVTPRRHLVELRT 90


tr_hit_id A7NVZ2
Definition tr|A7NVZ2|A7NVZ2_VITVI Chromosome chr5 scaffold_2, whole genome shotgun sequence OS=Vitis vinifera
Align length 95
Score (bit) 135.0
E-value 2.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916924|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_F05.
(610 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7NVZ2|A7NVZ2_VITVI Chromosome chr5 scaffold_2, whole genome ... 135 2e-30
tr|A9PFR0|A9PFR0_POPTR Putative uncharacterized protein OS=Popul... 133 9e-30
tr|A5BYZ8|A5BYZ8_VITVI Putative uncharacterized protein OS=Vitis... 132 1e-29
tr|Q9LIT4|Q9LIT4_ORYSJ cDNA clone:J033064P19, full insert sequen... 123 7e-27
tr|B8ABS3|B8ABS3_ORYSI Putative uncharacterized protein OS=Oryza... 123 7e-27
tr|A2ZRB6|A2ZRB6_ORYSJ Putative uncharacterized protein OS=Oryza... 123 7e-27
tr|B6TFD9|B6TFD9_MAIZE 50S ribosomal protein L3-2 OS=Zea mays PE... 123 1e-26
tr|B4FAB5|B4FAB5_MAIZE Putative uncharacterized protein OS=Zea m... 121 3e-26
tr|A9S5J3|A9S5J3_PHYPA Predicted protein OS=Physcomitrella paten... 115 2e-24
tr|Q00RY2|Q00RY2_OSTTA Putative ribosomal protein L3 (ISS) OS=Os... 85 4e-15
tr|Q22HG3|Q22HG3_TETTH Ribosomal protein L3 containing protein (... 85 4e-15
tr|A4SAF0|A4SAF0_OSTLU Putative mitochondrial ribosomal protein ... 84 8e-15
tr|A0DEC4|A0DEC4_PARTE Chromosome undetermined scaffold_48, whol... 82 2e-14
tr|A0D1W5|A0D1W5_PARTE Chromosome undetermined scaffold_34, whol... 82 2e-14
tr|A8HPX6|A8HPX6_CHLRE Mitochondrial ribosomal protein L3 OS=Chl... 80 1e-13
tr|B8H4D4|B8H4D4_CAUCR LSU ribosomal protein L3P OS=Caulobacter ... 74 9e-12
tr|A8TZL6|A8TZL6_9PROT 50S ribosomal protein L3 OS=alpha proteob... 74 9e-12
tr|B0QSJ0|B0QSJ0_HAEPR 50S ribosomal protein L3 OS=Haemophilus p... 72 3e-11
tr|A4NXB2|A4NXB2_HAEIN 50S ribosomal protein L3 OS=Haemophilus i... 72 3e-11
tr|A4NPH3|A4NPH3_HAEIN 50S ribosomal protein L3 OS=Haemophilus i... 72 3e-11
tr|A4NK71|A4NK71_HAEIN 50S ribosomal protein L3 OS=Haemophilus i... 72 3e-11
tr|A4NF48|A4NF48_HAEIN 50S ribosomal protein L3 OS=Haemophilus i... 72 3e-11
tr|A4N7H9|A4N7H9_HAEIN 50S ribosomal protein L3 OS=Haemophilus i... 72 3e-11
tr|A4N316|A4N316_HAEIN 50S ribosomal protein L3 OS=Haemophilus i... 72 3e-11
tr|A4MWU9|A4MWU9_HAEIN 50S ribosomal protein L3 OS=Haemophilus i... 72 3e-11
tr|B8F755|B8F755_HAEPR 50S ribosomal protein L3 OS=Haemophilus p... 72 3e-11
tr|B8C6P6|B8C6P6_THAPS Predicted protein (Fragment) OS=Thalassio... 72 3e-11
tr|B8GV58|B8GV58_9GAMM Ribosomal protein L3 OS=Thioalkalivibrio ... 70 7e-11
tr|B3GZ11|B3GZ11_ACTP7 50S ribosomal protein L3 OS=Actinobacillu... 70 1e-10
tr|B0BST1|B0BST1_ACTPJ Ribosomal protein L3 OS=Actinobacillus pl... 70 1e-10

>tr|A7NVZ2|A7NVZ2_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019720001
PE=3 SV=1
Length = 307

Score = 135 bits (339), Expect = 2e-30
Identities = 66/95 (69%), Positives = 74/95 (77%)
Frame = +2

Query: 311 ISTRPREMTADSCRTGAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTA 490
I +P M+ +S RTGAIA+KCGM+A WDKWGARVP TVLW D N+V+QVK K+ A
Sbjct: 46 IVPKPGVMSPNSKRTGAIAVKCGMSALWDKWGARVPITVLWLDDNIVSQVKTFEKEGLNA 105

Query: 491 LQVGCGLKKAKQLTKPEVGHFIKQGVPLKRKLTEF 595
LQVGCG KKAK LTKPEVGHF QGVPLKRKL EF
Sbjct: 106 LQVGCGQKKAKHLTKPEVGHFRAQGVPLKRKLREF 140


>tr|A9PFR0|A9PFR0_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 315

Score = 133 bits (334), Expect = 9e-30
Identities = 63/95 (66%), Positives = 72/95 (75%)
Frame = +2

Query: 311 ISTRPREMTADSCRTGAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTA 490
I +P MT +S RTG +A+KCGMTA WDKWGAR+P TVLW D N+V+QVK K+ A
Sbjct: 56 IEAKPGVMTPNSKRTGVVAVKCGMTALWDKWGARIPITVLWVDDNIVSQVKTVEKEGFFA 115

Query: 491 LQVGCGLKKAKQLTKPEVGHFIKQGVPLKRKLTEF 595
LQVGCG KK K LTKPEVGHF QGVP+KRKL EF
Sbjct: 116 LQVGCGQKKEKHLTKPEVGHFRAQGVPMKRKLREF 150


>tr|A5BYZ8|A5BYZ8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_033846 PE=3 SV=1
Length = 243

Score = 132 bits (333), Expect = 1e-29
Identities = 64/88 (72%), Positives = 71/88 (80%)
Frame = +2

Query: 332 MTADSCRTGAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTALQVGCGL 511
M+ +S RTGAIA+KCGM+A WDKWGARVP TVLW D N+V+QVK K+ ALQVGCG
Sbjct: 1 MSPNSKRTGAIAVKCGMSALWDKWGARVPITVLWLDDNIVSQVKTFEKEGXNALQVGCGQ 60

Query: 512 KKAKQLTKPEVGHFIKQGVPLKRKLTEF 595
KKAK LTKPEVGHF QGVPLKRKL EF
Sbjct: 61 KKAKHLTKPEVGHFRAQGVPLKRKLREF 88


>tr|Q9LIT4|Q9LIT4_ORYSJ cDNA clone:J033064P19, full insert sequence
OS=Oryza sativa subsp. japonica GN=P0434D08.21 PE=2 SV=1
Length = 319

Score = 123 bits (309), Expect = 7e-27
Identities = 62/95 (65%), Positives = 67/95 (70%)
Frame = +2

Query: 311 ISTRPREMTADSCRTGAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTA 490
I R M DS RTG I +KCGM+A WDKWGA+VP TVLW D NVV QVK K+ A
Sbjct: 61 IEARAGVMGPDSRRTGVIGVKCGMSAMWDKWGAKVPITVLWVDDNVVCQVKTAEKEGFFA 120

Query: 491 LQVGCGLKKAKQLTKPEVGHFIKQGVPLKRKLTEF 595
LQ+G G KK K LTKPEVGHF QGVPLKRKL EF
Sbjct: 121 LQLGAGQKKEKHLTKPEVGHFRAQGVPLKRKLREF 155


>tr|B8ABS3|B8ABS3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_01192 PE=4 SV=1
Length = 319

Score = 123 bits (309), Expect = 7e-27
Identities = 62/95 (65%), Positives = 67/95 (70%)
Frame = +2

Query: 311 ISTRPREMTADSCRTGAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTA 490
I R M DS RTG I +KCGM+A WDKWGA+VP TVLW D NVV QVK K+ A
Sbjct: 61 IEARAGVMGPDSRRTGVIGVKCGMSAMWDKWGAKVPITVLWVDDNVVCQVKTAEKEGFFA 120

Query: 491 LQVGCGLKKAKQLTKPEVGHFIKQGVPLKRKLTEF 595
LQ+G G KK K LTKPEVGHF QGVPLKRKL EF
Sbjct: 121 LQLGAGQKKEKHLTKPEVGHFRAQGVPLKRKLREF 155


>tr|A2ZRB6|A2ZRB6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_001088 PE=3 SV=1
Length = 322

Score = 123 bits (309), Expect = 7e-27
Identities = 62/95 (65%), Positives = 67/95 (70%)
Frame = +2

Query: 311 ISTRPREMTADSCRTGAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTA 490
I R M DS RTG I +KCGM+A WDKWGA+VP TVLW D NVV QVK K+ A
Sbjct: 61 IEARAGVMGPDSRRTGVIGVKCGMSAMWDKWGAKVPITVLWVDDNVVCQVKTAEKEGFFA 120

Query: 491 LQVGCGLKKAKQLTKPEVGHFIKQGVPLKRKLTEF 595
LQ+G G KK K LTKPEVGHF QGVPLKRKL EF
Sbjct: 121 LQLGAGQKKEKHLTKPEVGHFRAQGVPLKRKLREF 155


>tr|B6TFD9|B6TFD9_MAIZE 50S ribosomal protein L3-2 OS=Zea mays PE=2
SV=1
Length = 318

Score = 123 bits (308), Expect = 1e-26
Identities = 62/95 (65%), Positives = 67/95 (70%)
Frame = +2

Query: 311 ISTRPREMTADSCRTGAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTA 490
I R M S RTG I +KCGM+A WDKWGA+VP TVLW D NVVTQVK K+ A
Sbjct: 58 IEARSGVMGPTSRRTGVIGVKCGMSAMWDKWGAKVPITVLWVDDNVVTQVKTAEKEGFFA 117

Query: 491 LQVGCGLKKAKQLTKPEVGHFIKQGVPLKRKLTEF 595
LQ+G G KK K LTKPEVGHF QGVPLKRKL EF
Sbjct: 118 LQLGAGQKKEKHLTKPEVGHFRAQGVPLKRKLREF 152


>tr|B4FAB5|B4FAB5_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 254

Score = 121 bits (304), Expect = 3e-26
Identities = 60/88 (68%), Positives = 65/88 (73%)
Frame = +2

Query: 332 MTADSCRTGAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTALQVGCGL 511
M S RTG I +KCGM+A WDKWGA+VP TVLW D NVVTQVK K+ ALQ+G G
Sbjct: 1 MGPTSRRTGVIGVKCGMSAMWDKWGAKVPITVLWVDDNVVTQVKTAEKEGFFALQLGAGQ 60

Query: 512 KKAKQLTKPEVGHFIKQGVPLKRKLTEF 595
KK K LTKPEVGHF QGVPLKRKL EF
Sbjct: 61 KKEKHLTKPEVGHFRAQGVPLKRKLREF 88


>tr|A9S5J3|A9S5J3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_124350 PE=3 SV=1
Length = 258

Score = 115 bits (289), Expect = 2e-24
Identities = 56/85 (65%), Positives = 63/85 (74%)
Frame = +2

Query: 341 DSCRTGAIAIKCGMTAGWDKWGARVPYTVLWFDHNVVTQVKVEGKDCTTALQVGCGLKKA 520
+S RTG IA+KCGMTA WDKWGARVP TVLW + N V QVK E D ALQ+G G +K
Sbjct: 11 ESFRTGVIAVKCGMTAIWDKWGARVPMTVLWVNDNHVVQVKTEETDGHFALQIGAGQRKP 70

Query: 521 KQLTKPEVGHFIKQGVPLKRKLTEF 595
KQLTKPE+GHF GVPLK+ L EF
Sbjct: 71 KQLTKPELGHFRAAGVPLKQHLAEF 95


>tr|Q00RY2|Q00RY2_OSTTA Putative ribosomal protein L3 (ISS)
OS=Ostreococcus tauri GN=Ot20g00340 PE=3 SV=1
Length = 312

Score = 84.7 bits (208), Expect = 4e-15
Identities = 48/109 (44%), Positives = 63/109 (57%), Gaps = 1/109 (0%)
Frame = +2

Query: 275 SVEDAAKAKGVEISTRPREMTADSCRTGAIAIKCGMTAGWDKWGARVPYTVLWFDH-NVV 451
++ AK ST PR RTGAI IKCGMTA WD G R TV+W D VV
Sbjct: 43 AIHRVVDAKTSSSSTAPR-------RTGAIGIKCGMTADWDARGCRHALTVVWLDGVEVV 95

Query: 452 TQVKVEGKDCTTALQVGCGLKKAKQLTKPEVGHFIKQGVPLKRKLTEFQ 598
+ +G + A+Q+G G +KAK +TK E+GHF++ G +KR L EF+
Sbjct: 96 RRTGRDGANGYDAVQIGYGARKAKGVTKAELGHFVRHGSGIKRGLKEFR 144