BP916926
Clone id YMU001_000093_F07
Library
Length 368
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000093_F07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TCCTATGAGTTGCTCCTCCTGACTGTGTTAGTCTCTCCTGCAGCAACAATTCCCCTCGCA
TGGTTTCACAGCCTCCCTTTGAGCTGACTTCAATGCACTTCTCGCTACTCTCCTTTGCCA
AAGGGGGATCGACCAAAACCTTTTTGAGGGCCACAGTTTCATCACCTGCAAAAGAGGATA
CTTCACAGTTCTGTTCATCAACATTCAGCACAGTTACATTTTGTTTCTGCATTTCCTTAG
GATCTGCATCGACAGTTCGTAATTGAGTTGGCGCATGCTCTTCTAGCAGGTGATAGCTCT
CTCCTCCCTTTAAATGGTTACATGTTTCTGTCGGGTTCTCCAAAGAAACTGCAATTTCTT
CAGCTTTT
■■Homology search results ■■ -
sp_hit_id P07825
Definition sp|P07825|SYPH_RAT Synaptophysin OS=Rattus norvegicus
Align length 82
Score (bit) 34.7
E-value 0.15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916926|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_F07.
(368 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P07825|SYPH_RAT Synaptophysin OS=Rattus norvegicus GN=Syp PE=... 35 0.15
sp|Q62277|SYPH_MOUSE Synaptophysin OS=Mus musculus GN=Syp PE=1 SV=2 35 0.15
sp|P34948|MPI_CANAL Mannose-6-phosphate isomerase OS=Candida alb... 34 0.26
sp|Q8P4G1|RSMB_XANCP Ribosomal RNA small subunit methyltransfera... 32 0.99
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Ory... 30 2.9
sp|Q5R6F3|ZN512_PONAB Zinc finger protein 512 OS=Pongo abelii GN... 30 3.7
sp|Q95JV5|ZN512_MACFA Zinc finger protein 512 OS=Macaca fascicul... 30 3.7
sp|Q96ME7|ZN512_HUMAN Zinc finger protein 512 OS=Homo sapiens GN... 30 3.7
sp|Q9WUF3|C8AP2_MOUSE CASP8-associated protein 2 OS=Mus musculus... 30 3.7
sp|Q8PG22|RSMB_XANAC Ribosomal RNA small subunit methyltransfera... 30 4.9
sp|Q24325|TAF2_DROME Transcription initiation factor TFIID subun... 29 6.4
sp|Q8CB87|RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus... 29 6.4
sp|Q5E3N1|FLGI_VIBF1 Flagellar P-ring protein OS=Vibrio fischeri... 29 6.4
sp|Q1QW35|FLGI_CHRSD Flagellar P-ring protein OS=Chromohalobacte... 29 6.4
sp|Q03FM6|FTHS_PEDPA Formate--tetrahydrofolate ligase OS=Pedioco... 29 8.3
sp|P27895|CIN8_YEAST Kinesin-like protein CIN8 OS=Saccharomyces ... 29 8.3
sp|Q6FXI5|CIN8_CANGA Kinesin-like protein CIN8 OS=Candida glabra... 29 8.3

>sp|P07825|SYPH_RAT Synaptophysin OS=Rattus norvegicus GN=Syp PE=1
SV=1
Length = 307

Score = 34.7 bits (78), Expect = 0.15
Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 6/82 (7%)
Frame = +3

Query: 27 VSLSCSNNSPRMVS-----QPPFELTSMHFSLLSFAKGGSTKTFLRATVSSPAKEDTSQF 191
+S+ C+N + ++ + PF L ++F S KGG+TK FL SS A+
Sbjct: 47 LSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAE------ 100

Query: 192 CSSTFSTV-TFCFCISLGSAST 254
F TV F F S+G+ +T
Sbjct: 101 ---FFVTVAVFAFLYSMGALAT 119


>sp|Q62277|SYPH_MOUSE Synaptophysin OS=Mus musculus GN=Syp PE=1 SV=2
Length = 314

Score = 34.7 bits (78), Expect = 0.15
Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 6/82 (7%)
Frame = +3

Query: 27 VSLSCSNNSPRMVS-----QPPFELTSMHFSLLSFAKGGSTKTFLRATVSSPAKEDTSQF 191
+S+ C+N + ++ + PF L ++F S KGG+TK FL SS A+
Sbjct: 53 LSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAE------ 106

Query: 192 CSSTFSTV-TFCFCISLGSAST 254
F TV F F S+G+ +T
Sbjct: 107 ---FFVTVAVFAFLYSMGALAT 125


>sp|P34948|MPI_CANAL Mannose-6-phosphate isomerase OS=Candida
albicans GN=PMI1 PE=1 SV=2
Length = 441

Score = 33.9 bits (76), Expect = 0.26
Identities = 18/51 (35%), Positives = 29/51 (56%)
Frame = -2

Query: 205 NVDEQNCEVSSFAGDETVALKKVLVDPPLAKESSEKCIEVSSKGGCETMRG 53
+V++Q + F + A+K VL DPP+A+ S + I SKGG + + G
Sbjct: 327 SVEKQKMPLQEFPRSKGDAVKSVLYDPPIAEFSVLQTIFDKSKGGKQVIEG 377


>sp|Q8P4G1|RSMB_XANCP Ribosomal RNA small subunit methyltransferase
B OS=Xanthomonas campestris pv. campestris GN=rsmB PE=3
SV=1
Length = 437

Score = 32.0 bits (71), Expect = 0.99
Identities = 13/33 (39%), Positives = 20/33 (60%)
Frame = -2

Query: 307 GGESYHLLEEHAPTQLRTVDADPKEMQKQNVTV 209
GG++ HLLE H QL +D D + +++ TV
Sbjct: 259 GGKAAHLLERHPQLQLTALDVDARRLERVRQTV 291


>sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9
OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=3
SV=1
Length = 628

Score = 30.4 bits (67), Expect = 2.9
Identities = 13/18 (72%), Positives = 14/18 (77%)
Frame = +1

Query: 25 VLVSPAATIPLAWFHSLP 78
V+VS ATIP AWFHS P
Sbjct: 33 VVVSRRATIPAAWFHSSP 50


>sp|Q5R6F3|ZN512_PONAB Zinc finger protein 512 OS=Pongo abelii
GN=ZNF512 PE=2 SV=1
Length = 567

Score = 30.0 bits (66), Expect = 3.7
Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 6/52 (11%)
Frame = -2

Query: 352 AVSLENPTETCNHL------KGGESYHLLEEHAPTQLRTVDADPKEMQKQNV 215
A LE T C+H K G +YHL EH P P+ +++ N+
Sbjct: 279 AAELEKMTLKCHHCGKPYRSKAGLAYHLRSEHGPISFFPESGQPECLKEMNL 330


>sp|Q95JV5|ZN512_MACFA Zinc finger protein 512 OS=Macaca
fascicularis GN=ZNF512 PE=2 SV=1
Length = 565

Score = 30.0 bits (66), Expect = 3.7
Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 6/52 (11%)
Frame = -2

Query: 352 AVSLENPTETCNHL------KGGESYHLLEEHAPTQLRTVDADPKEMQKQNV 215
A LE T C+H K G +YHL EH P P+ +++ N+
Sbjct: 278 AAELEKMTLKCHHCGKPYRSKAGLAYHLRSEHGPISFFPESGQPECLKEMNL 329


>sp|Q96ME7|ZN512_HUMAN Zinc finger protein 512 OS=Homo sapiens
GN=ZNF512 PE=1 SV=1
Length = 567

Score = 30.0 bits (66), Expect = 3.7
Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 6/52 (11%)
Frame = -2

Query: 352 AVSLENPTETCNHL------KGGESYHLLEEHAPTQLRTVDADPKEMQKQNV 215
A LE T C+H K G +YHL EH P P+ +++ N+
Sbjct: 279 AAELEKMTLKCHHCGKPYRSKAGLAYHLRSEHGPISFFPESGQPECLKEMNL 330


>sp|Q9WUF3|C8AP2_MOUSE CASP8-associated protein 2 OS=Mus musculus
GN=Casp8ap2 PE=1 SV=1
Length = 1962

Score = 30.0 bits (66), Expect = 3.7
Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 2/72 (2%)
Frame = -2

Query: 256 TVDADPKEMQKQNVTVLNVDEQNCEVSSFAGDETVALKKVLVDPPLAKESSEKCIEVSSK 77
T DA + + + VL V+ C+V D K + PL E CI+++S+
Sbjct: 1720 THDASSESKNEGSEPVLAVEGMGCQVICIDEDTNKEGKMGRANSPLESIVEETCIDLTSE 1779

Query: 76 --GGCETMRGEL 47
G CE R L
Sbjct: 1780 SPGSCEIKRHNL 1791


>sp|Q8PG22|RSMB_XANAC Ribosomal RNA small subunit methyltransferase
B OS=Xanthomonas axonopodis pv. citri GN=rsmB PE=3 SV=1
Length = 436

Score = 29.6 bits (65), Expect = 4.9
Identities = 12/33 (36%), Positives = 20/33 (60%)
Frame = -2

Query: 307 GGESYHLLEEHAPTQLRTVDADPKEMQKQNVTV 209
GG++ HLLE H QL +D D + +++ T+
Sbjct: 258 GGKAAHLLERHPGLQLVALDVDARRLERVQQTL 290


tr_hit_id Q23682
Definition tr|Q23682|Q23682_CAEEL Guanylate cyclase OS=Caenorhabditis elegans
Align length 89
Score (bit) 38.1
E-value 0.22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916926|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_F07.
(368 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q23682|Q23682_CAEEL Guanylate cyclase OS=Caenorhabditis elega... 38 0.22
tr|A8WPH0|A8WPH0_CAEBR Guanylate cyclase OS=Caenorhabditis brigg... 38 0.22
tr|Q9K1N0|Q9K1N0_NEIMB DnaK suppressor protein OS=Neisseria meni... 37 0.49
tr|A9LZV4|A9LZV4_NEIM0 DnaK suppressor protein OS=Neisseria meni... 37 0.49
tr|A1KR88|A1KR88_NEIMF Putative DnaK suppressor protein OS=Neiss... 37 0.49
tr|A1IP66|A1IP66_NEIMA Putative DnaK suppressor protein OS=Neiss... 37 0.49
tr|B0VQ13|B0VQ13_ACIBS 16S rRNA m5C967 SAM-dependent methyltrans... 36 1.1
tr|B0VAD9|B0VAD9_ACIBY 16S rRNA m5C967 SAM-dependent methyltrans... 36 1.1
tr|A3MAA2|A3MAA2_ACIBT 16S rRNA m5C967 SAM-dependent methyltrans... 36 1.1
tr|B7I2C4|B7I2C4_ACIBA Ribosomal RNA small subunit methyltransfe... 36 1.1
tr|B7GUZ6|B7GUZ6_ACIBA Ribosomal RNA small subunit methyltransfe... 36 1.1
tr|Q5F5L9|Q5F5L9_NEIG1 Putative dosage-dependent DnaK suppressor... 35 1.4
tr|B4RPT0|B4RPT0_NEIG2 DskA OS=Neisseria gonorrhoeae (strain NCC... 35 1.4
tr|Q9LHT8|Q9LHT8_ARATH Gb|AAD20426.1 OS=Arabidopsis thaliana GN=... 35 1.4
tr|B2I2H8|B2I2H8_ACIBC tRNA and rRNA cytosine-C5-methylase OS=Ac... 35 1.9
tr|Q5F3F6|Q5F3F6_CHICK Putative uncharacterized protein OS=Gallu... 35 2.4
tr|Q4QXL0|Q4QXL0_OXYSC Golgi-associated protein (Fragment) OS=Ox... 35 2.4
tr|B1AVA8|B1AVA8_MOUSE Synaptophysin (Fragment) OS=Mus musculus ... 35 2.4
tr|B1AVA7|B1AVA7_MOUSE Synaptophysin OS=Mus musculus GN=Syp PE=4... 35 2.4
tr|A4FUR8|A4FUR8_MOUSE Syp protein (Fragment) OS=Mus musculus GN... 35 2.4
tr|B0EUW6|B0EUW6_ENTDI Ras guanine nucleotide exchange factor, s... 35 2.4
tr|Q9FYW6|Q9FYW6_SOLLC BAC19.10 OS=Solanum lycopersicum PE=4 SV=1 33 5.4
tr|Q5U4E7|Q5U4E7_RAT Arhgap11a protein (Fragment) OS=Rattus norv... 33 7.1
tr|A9DJP9|A9DJP9_9FLAO Putative transcriptional regulator OS=Kor... 33 7.1
tr|Q9LP30|Q9LP30_ARATH T9L6.4 protein OS=Arabidopsis thaliana GN... 33 7.1
tr|Q9RX24|Q9RX24_DEIRA Putative uncharacterized protein OS=Deino... 33 9.3
tr|Q6F6P8|Q6F6P8_ACIAD 16S rRNA m5C967 SAM-dependent methyltrans... 33 9.3
tr|Q7QG95|Q7QG95_ANOGA AGAP010623-PA (Fragment) OS=Anopheles gam... 33 9.3

>tr|Q23682|Q23682_CAEEL Guanylate cyclase OS=Caenorhabditis elegans
GN=gcy-5 PE=2 SV=1
Length = 1122

Score = 38.1 bits (87), Expect = 0.22
Identities = 28/89 (31%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
Frame = -2

Query: 289 LLEEHAPTQLRTVDADPKEMQKQNVTVLNVDEQNCEVSSFA-GDETVALKKVLVDPPLAK 113
LLEEH P++ R + A P E+ + ++T+ +D + +V SFA + K+ D K
Sbjct: 699 LLEEHTPSKKRLLWAAP-EVLRGSLTIHQMD-PSADVYSFAIIASEILTKREAWDISNRK 756

Query: 112 ESSEKCIEVSSKGGCETMRGELLLQERLT 26
E +++ + + KGG T+R EL+L ++
Sbjct: 757 EGADEILYMVKKGGNRTIRPELILDAEVS 785


>tr|A8WPH0|A8WPH0_CAEBR Guanylate cyclase OS=Caenorhabditis briggsae
GN=Cbr-gcy-5 PE=3 SV=2
Length = 1242

Score = 38.1 bits (87), Expect = 0.22
Identities = 29/91 (31%), Positives = 49/91 (53%), Gaps = 1/91 (1%)
Frame = -2

Query: 289 LLEEHAPTQLRTVDADPKEMQKQNVTVLNVDEQNCEVSSFA-GDETVALKKVLVDPPLAK 113
LLEEH PT+ R + A P E+ + ++TV +D + +V SFA + K+ D K
Sbjct: 818 LLEEHTPTKRRLLWAAP-EVLRGSLTVSQMD-PSADVYSFAIVASEILTKREAWDFANRK 875

Query: 112 ESSEKCIEVSSKGGCETMRGELLLQERLTQS 20
E +++ + + KGG +R EL+ ++ S
Sbjct: 876 EGADEILYMIKKGGARAVRPELIPDAEVSPS 906


>tr|Q9K1N0|Q9K1N0_NEIMB DnaK suppressor protein OS=Neisseria
meningitidis serogroup B GN=dksA PE=4 SV=1
Length = 138

Score = 37.0 bits (84), Expect = 0.49
Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 8/90 (8%)
Frame = -2

Query: 343 LENPTETCNHLKGGESYH------LLEEHAPTQLRTVDADPKEMQKQNVTVLNVDEQNCE 182
+EN + T HL+ ES EE +LRT D + K + K T+ N+DE +
Sbjct: 40 IENASATTGHLQEHESAPDPADRATQEEEYALELRTRDRERKLLSKIQATIRNIDEGDYG 99

Query: 181 VSSFAGDETVALKKVLVDP--PLAKESSEK 98
+ G E + LK++L P L+ ES E+
Sbjct: 100 FCADTG-EPIGLKRLLARPTATLSVESQER 128


>tr|A9LZV4|A9LZV4_NEIM0 DnaK suppressor protein OS=Neisseria
meningitidis serogroup C (strain 053442) GN=dksA PE=4
SV=1
Length = 138

Score = 37.0 bits (84), Expect = 0.49
Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 8/90 (8%)
Frame = -2

Query: 343 LENPTETCNHLKGGESYH------LLEEHAPTQLRTVDADPKEMQKQNVTVLNVDEQNCE 182
+EN + T HL+ ES EE +LRT D + K + K T+ N+DE +
Sbjct: 40 IENASATTGHLQEHESAPDPADRATQEEEYALELRTRDRERKLLSKIQATIRNIDEGDYG 99

Query: 181 VSSFAGDETVALKKVLVDP--PLAKESSEK 98
+ G E + LK++L P L+ ES E+
Sbjct: 100 FCADTG-EPIGLKRLLARPTATLSVESQER 128


>tr|A1KR88|A1KR88_NEIMF Putative DnaK suppressor protein
OS=Neisseria meningitidis serogroup C / serotype 2a
(strain ATCC 700532 / FAM18) GN=dksA PE=4 SV=1
Length = 138

Score = 37.0 bits (84), Expect = 0.49
Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 8/90 (8%)
Frame = -2

Query: 343 LENPTETCNHLKGGESYH------LLEEHAPTQLRTVDADPKEMQKQNVTVLNVDEQNCE 182
+EN + T HL+ ES EE +LRT D + K + K T+ N+DE +
Sbjct: 40 IENASATTGHLQEHESAPDPADRATQEEEYALELRTRDRERKLLSKIQATIRNIDEGDYG 99

Query: 181 VSSFAGDETVALKKVLVDP--PLAKESSEK 98
+ G E + LK++L P L+ ES E+
Sbjct: 100 FCADTG-EPIGLKRLLARPTATLSVESQER 128


>tr|A1IP66|A1IP66_NEIMA Putative DnaK suppressor protein
OS=Neisseria meningitidis serogroup A GN=NMA0213 PE=4
SV=1
Length = 138

Score = 37.0 bits (84), Expect = 0.49
Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 8/90 (8%)
Frame = -2

Query: 343 LENPTETCNHLKGGESYH------LLEEHAPTQLRTVDADPKEMQKQNVTVLNVDEQNCE 182
+EN + T HL+ ES EE +LRT D + K + K T+ N+DE +
Sbjct: 40 IENASATTGHLQEHESAPDPADRATQEEEYALELRTRDRERKLLSKIQATIRNIDEGDYG 99

Query: 181 VSSFAGDETVALKKVLVDP--PLAKESSEK 98
+ G E + LK++L P L+ ES E+
Sbjct: 100 FCADTG-EPIGLKRLLARPTATLSVESQER 128


>tr|B0VQ13|B0VQ13_ACIBS 16S rRNA m5C967 SAM-dependent
methyltransferase OS=Acinetobacter baumannii (strain
SDF) GN=sun PE=4 SV=1
Length = 434

Score = 35.8 bits (81), Expect = 1.1
Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%)
Frame = -2

Query: 307 GGESYHLLEEHAPTQLRTVDADPKEMQK--QNVTVLNVDEQNCEVSSFAGDET 155
GG++ HLLE+ P QL +D DP + + +N+ L +D+ + E+ A D T
Sbjct: 258 GGKTAHLLEKFKPAQLIAIDQDPSRLVRVTENLNRLALDQSHTEI--LAADAT 308


>tr|B0VAD9|B0VAD9_ACIBY 16S rRNA m5C967 SAM-dependent
methyltransferase OS=Acinetobacter baumannii (strain
AYE) GN=sun PE=4 SV=1
Length = 434

Score = 35.8 bits (81), Expect = 1.1
Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%)
Frame = -2

Query: 307 GGESYHLLEEHAPTQLRTVDADPKEMQK--QNVTVLNVDEQNCEVSSFAGDET 155
GG++ HLLE+ P QL +D DP + + +N+ L +D+ + E+ A D T
Sbjct: 258 GGKTAHLLEKFKPAQLIAIDQDPSRLVRVTENLNRLALDQSHTEI--LAADAT 308


>tr|A3MAA2|A3MAA2_ACIBT 16S rRNA m5C967 SAM-dependent
methyltransferase OS=Acinetobacter baumannii (strain
ATCC 17978 / NCDC KC 755) GN=A1S_3457 PE=4 SV=2
Length = 434

Score = 35.8 bits (81), Expect = 1.1
Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%)
Frame = -2

Query: 307 GGESYHLLEEHAPTQLRTVDADPKEMQK--QNVTVLNVDEQNCEVSSFAGDET 155
GG++ HLLE+ P QL +D DP + + +N+ L +D+ + E+ A D T
Sbjct: 258 GGKTAHLLEKFKPAQLIAIDQDPSRLVRVTENLNRLALDQSHTEI--LAADAT 308


>tr|B7I2C4|B7I2C4_ACIBA Ribosomal RNA small subunit
methyltransferase B OS=Acinetobacter baumannii AB0057
GN=sun PE=4 SV=1
Length = 434

Score = 35.8 bits (81), Expect = 1.1
Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%)
Frame = -2

Query: 307 GGESYHLLEEHAPTQLRTVDADPKEMQK--QNVTVLNVDEQNCEVSSFAGDET 155
GG++ HLLE+ P QL +D DP + + +N+ L +D+ + E+ A D T
Sbjct: 258 GGKTAHLLEKFKPAQLIAIDQDPSRLVRVTENLNRLALDQSHTEI--LAADAT 308