BP916936
Clone id YMU001_000093_G06
Library
Length 454
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000093_G06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTTTTGACAAAACACCTTTTTCTTGAAACTTTTTATTAATCATTTTGATTTCTTTACGAC
CAAGATTTTCAAGTAGGCACGAAGTTTTGCTCGCGGGTCAAGAACTTCAGTTGCACTTGG
TGGTCGCTGTAGGACATCATCCTCAGCACTCCCTTTATAAGTCCTGTTTTCACTCTTCAA
AATATCCCTGACTAATCTTCTTAGTTCTTGTCTATTGAAGGATGCCGATCTGATGGAATA
AACTTCAGCAATAACATCAGGATCTCCAGACAGTAGCCCCTGTAACCACCTATCTACAAT
GTCCTTGTCATGCTCCATTTGGTCAAGTTCACCCTCACTTAAGGAGCTCTCTGATTCATC
ATCCTCATCTTCCTCCTCATCCAAGTCATCCTCATAATCATCATTATCACTATCATTGTC
GTAATCGTCACTATTATCCTCAGTCTTCTCTCTC
■■Homology search results ■■ -
sp_hit_id Q06367
Definition sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus
Align length 29
Score (bit) 30.0
E-value 4.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916936|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_G06.
(454 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus GN=... 30 4.9
sp|Q3KI17|Y846_PSEPF UPF0307 protein Pfl01_0846 OS=Pseudomonas f... 30 6.4
sp|Q8CNL2|LEU3_STAES 3-isopropylmalate dehydrogenase OS=Staphylo... 30 6.4
sp|Q5HMF8|LEU3_STAEQ 3-isopropylmalate dehydrogenase OS=Staphylo... 30 6.4
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidops... 29 8.4

>sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus
GN=CYP1A1 PE=1 SV=1
Length = 516

Score = 30.0 bits (66), Expect = 4.9
Identities = 15/29 (51%), Positives = 20/29 (68%)
Frame = -1

Query: 106 SS*PASKTSCLLENLGRKEIKMINKKFQE 20
+S PAS +SC LE +KE + + KKFQE
Sbjct: 144 ASDPASVSSCYLEEHVKKEAEYLIKKFQE 172


>sp|Q3KI17|Y846_PSEPF UPF0307 protein Pfl01_0846 OS=Pseudomonas
fluorescens (strain Pf0-1) GN=Pfl01_0846 PE=3 SV=2
Length = 174

Score = 29.6 bits (65), Expect = 6.4
Identities = 18/63 (28%), Positives = 31/63 (49%)
Frame = -2

Query: 297 VDRWLQGLLSGDPDVIAEVYSIRSASFNRQELRRLVRDILKSENRTYKGSAEDDVLQRPP 118
++RW L++GD D + E + + +RQ+LR L+R A+ +V Q P
Sbjct: 106 LERWRDRLIAGD-DAVLEKFVVDYPDADRQQLRSLIR------------QAQHEVAQNKP 152

Query: 117 SAT 109
A+
Sbjct: 153 PAS 155


>sp|Q8CNL2|LEU3_STAES 3-isopropylmalate dehydrogenase
OS=Staphylococcus epidermidis (strain ATCC 12228)
GN=leuB PE=3 SV=1
Length = 347

Score = 29.6 bits (65), Expect = 6.4
Identities = 15/52 (28%), Positives = 25/52 (48%)
Frame = -2

Query: 309 DKDIVDRWLQGLLSGDPDVIAEVYSIRSASFNRQELRRLVRDILKSENRTYK 154
D IV G+ G+P + + ++ S ++ QE+ R+VR NR K
Sbjct: 127 DLVIVRELTSGIYFGEPSYVKKTEALDSLKYSSQEIERIVRIAFNLANRRRK 178


>sp|Q5HMF8|LEU3_STAEQ 3-isopropylmalate dehydrogenase
OS=Staphylococcus epidermidis (strain ATCC 35984 /
RP62A) GN=leuB PE=3 SV=1
Length = 347

Score = 29.6 bits (65), Expect = 6.4
Identities = 15/52 (28%), Positives = 25/52 (48%)
Frame = -2

Query: 309 DKDIVDRWLQGLLSGDPDVIAEVYSIRSASFNRQELRRLVRDILKSENRTYK 154
D IV G+ G+P + + ++ S ++ QE+ R+VR NR K
Sbjct: 127 DLVIVRELTSGIYFGEPSYVKKTEALDSLKYSSQEIERIVRIAFNLANRRRK 178


>sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis
thaliana GN=KEG PE=1 SV=2
Length = 1625

Score = 29.3 bits (64), Expect = 8.4
Identities = 16/33 (48%), Positives = 19/33 (57%)
Frame = +1

Query: 58 DQDFQVGTKFCSRVKNFSCTWWSL*DIILSTPF 156
D+D VG FC R K FSC S+ D+ TPF
Sbjct: 1150 DEDGDVGIAFCFRSKPFSC---SVTDVEKVTPF 1179


tr_hit_id A7NSU1
Definition tr|A7NSU1|A7NSU1_VITVI Chromosome chr18 scaffold_1, whole genome shotgun sequence OS=Vitis vinifera
Align length 57
Score (bit) 52.0
E-value 1.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916936|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_G06.
(454 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7NSU1|A7NSU1_VITVI Chromosome chr18 scaffold_1, whole genome... 52 1e-05
tr|Q7XNX4|Q7XNX4_ORYSJ Os04g0250700 protein OS=Oryza sativa subs... 50 4e-05
tr|Q7XNQ8|Q7XNQ8_ORYSJ OSJNBa0033H08.17 protein (Putative unchar... 50 4e-05
tr|Q01KW7|Q01KW7_ORYSA H0211A12.7 protein OS=Oryza sativa GN=H02... 50 4e-05
tr|A2XR23|A2XR23_ORYSI Putative uncharacterized protein OS=Oryza... 50 4e-05
tr|B6TA17|B6TA17_MAIZE Kinesin heavy chain isolog OS=Zea mays PE... 48 3e-04
tr|Q9SU42|Q9SU42_ARATH Putative uncharacterized protein AT4g2417... 47 5e-04
tr|Q8VY50|Q8VY50_ARATH Putative uncharacterized protein At4g2417... 47 5e-04
tr|O22974|O22974_ARATH Kinesin heavy chain isolog OS=Arabidopsis... 47 5e-04
tr|A5AWT8|A5AWT8_VITVI Putative uncharacterized protein OS=Vitis... 40 0.076
tr|A9S1G2|A9S1G2_PHYPA Predicted protein OS=Physcomitrella paten... 39 0.099
tr|B0MJR6|B0MJR6_9FIRM Putative uncharacterized protein OS=Eubac... 37 0.49
tr|Q52178|Q52178_9BACL Rep protein OS=Brevibacillus borstelensis... 36 0.84
tr|Q2K0I3|Q2K0I3_RHIEC Probable oligopeptide ABC transporter, AT... 34 4.2
tr|Q6FWE0|Q6FWE0_CANGA Strain CBS138 chromosome D complete seque... 34 4.2
tr|B6A3T1|B6A3T1_RHILW Extracellular solute-binding protein fami... 33 7.1
tr|A9WDB7|A9WDB7_CHLAA Putative uncharacterized protein OS=Chlor... 33 7.1
tr|B2QP81|B2QP81_9CHLR Putative uncharacterized protein OS=Chlor... 33 7.1
tr|B4LF58|B4LF58_DROVI GJ13696 OS=Drosophila virilis GN=GJ13696 ... 33 7.1
tr|B8MDH8|B8MDH8_9EURO Sugar transporter, putative OS=Talaromyce... 33 7.1
tr|Q3SLT5|Q3SLT5_THIDA Putative uncharacterized protein OS=Thiob... 33 9.3
tr|A8IV47|A8IV47_CHLRE Predicted protein OS=Chlamydomonas reinha... 33 9.3

>tr|A7NSU1|A7NSU1_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00014405001
PE=4 SV=1
Length = 295

Score = 52.0 bits (123), Expect = 1e-05
Identities = 26/57 (45%), Positives = 35/57 (61%)
Frame = -2

Query: 303 DIVDRWLQGLLSGDPDVIAEVYSIRSASFNRQELRRLVRDILKSENRTYKGSAEDDV 133
DI RW GL++ D DV EVYS++S F+RQELR+LVR + + E+DV
Sbjct: 216 DIATRWSDGLINKDIDVTNEVYSVQSVEFDRQELRKLVRKVHSIQGHQAIIKEEEDV 272


>tr|Q7XNX4|Q7XNX4_ORYSJ Os04g0250700 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0026I12.6 PE=2 SV=2
Length = 276

Score = 50.4 bits (119), Expect = 4e-05
Identities = 22/41 (53%), Positives = 30/41 (73%)
Frame = -2

Query: 303 DIVDRWLQGLLSGDPDVIAEVYSIRSASFNRQELRRLVRDI 181
+I DRW +GLLS D V E+Y+I + F+RQELR+LVR +
Sbjct: 195 EIADRWFEGLLSKDISVTNEIYAIHNVEFDRQELRKLVRTV 235


>tr|Q7XNQ8|Q7XNQ8_ORYSJ OSJNBa0033H08.17 protein (Putative
uncharacterized protein) (OSJNBa0024J22.22 protein)
OS=Oryza sativa subsp. japonica GN=OSJNBa0033H08.17 PE=4
SV=2
Length = 276

Score = 50.4 bits (119), Expect = 4e-05
Identities = 22/41 (53%), Positives = 30/41 (73%)
Frame = -2

Query: 303 DIVDRWLQGLLSGDPDVIAEVYSIRSASFNRQELRRLVRDI 181
+I DRW +GLLS D V E+Y+I + F+RQELR+LVR +
Sbjct: 195 EIADRWFEGLLSKDISVTNEIYAIHNVEFDRQELRKLVRTV 235


>tr|Q01KW7|Q01KW7_ORYSA H0211A12.7 protein OS=Oryza sativa
GN=H0211A12.7 PE=4 SV=1
Length = 276

Score = 50.4 bits (119), Expect = 4e-05
Identities = 22/41 (53%), Positives = 30/41 (73%)
Frame = -2

Query: 303 DIVDRWLQGLLSGDPDVIAEVYSIRSASFNRQELRRLVRDI 181
+I DRW +GLLS D V E+Y+I + F+RQELR+LVR +
Sbjct: 195 EIADRWFEGLLSKDISVTNEIYAIHNVEFDRQELRKLVRTV 235


>tr|A2XR23|A2XR23_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_15093 PE=4 SV=1
Length = 276

Score = 50.4 bits (119), Expect = 4e-05
Identities = 22/41 (53%), Positives = 30/41 (73%)
Frame = -2

Query: 303 DIVDRWLQGLLSGDPDVIAEVYSIRSASFNRQELRRLVRDI 181
+I DRW +GLLS D V E+Y+I + F+RQELR+LVR +
Sbjct: 195 EIADRWFEGLLSKDISVTNEIYAIHNVEFDRQELRKLVRTV 235


>tr|B6TA17|B6TA17_MAIZE Kinesin heavy chain isolog OS=Zea mays PE=2
SV=1
Length = 274

Score = 47.8 bits (112), Expect = 3e-04
Identities = 24/54 (44%), Positives = 30/54 (55%)
Frame = -2

Query: 300 IVDRWLQGLLSGDPDVIAEVYSIRSASFNRQELRRLVRDILKSENRTYKGSAED 139
I DRW GLL D V EVYS+ S F+RQELR+LV+ + T E+
Sbjct: 195 IADRWFDGLLCKDISVTNEVYSVHSVEFDRQELRKLVKRAHMFQESTQNKDGEE 248


>tr|Q9SU42|Q9SU42_ARATH Putative uncharacterized protein AT4g24170
OS=Arabidopsis thaliana GN=AT4g24170 PE=1 SV=1
Length = 1263

Score = 47.0 bits (110), Expect = 5e-04
Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 1/52 (1%)
Frame = -2

Query: 291 RWLQGLLSGDPDVIAEVYSIRSASFNRQELRRLVRDI-LKSENRTYKGSAED 139
RW GL+S + ++ EVYS++S F+RQELR+LVR + L E R KG+ E+
Sbjct: 1178 RWFDGLISQNVELTKEVYSLQSVDFDRQELRKLVRKVQLVHEQR--KGTTEE 1227


>tr|Q8VY50|Q8VY50_ARATH Putative uncharacterized protein At4g24170
(Putative uncharacterized protein) OS=Arabidopsis
thaliana GN=At4g24170 PE=2 SV=1
Length = 306

Score = 47.0 bits (110), Expect = 5e-04
Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 1/52 (1%)
Frame = -2

Query: 291 RWLQGLLSGDPDVIAEVYSIRSASFNRQELRRLVRDI-LKSENRTYKGSAED 139
RW GL+S + ++ EVYS++S F+RQELR+LVR + L E R KG+ E+
Sbjct: 221 RWFDGLISQNVELTKEVYSLQSVDFDRQELRKLVRKVQLVHEQR--KGTTEE 270


>tr|O22974|O22974_ARATH Kinesin heavy chain isolog OS=Arabidopsis
thaliana GN=T19F6.3 PE=3 SV=1
Length = 995

Score = 47.0 bits (110), Expect = 5e-04
Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 1/52 (1%)
Frame = -2

Query: 291 RWLQGLLSGDPDVIAEVYSIRSASFNRQELRRLVRDI-LKSENRTYKGSAED 139
RW GL+S + ++ EVYS++S F+RQELR+LVR + L E R KG+ E+
Sbjct: 910 RWFDGLISQNVELTKEVYSLQSVDFDRQELRKLVRKVQLVHEQR--KGTTEE 959


>tr|A5AWT8|A5AWT8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_043591 PE=4 SV=1
Length = 598

Score = 39.7 bits (91), Expect = 0.076
Identities = 26/76 (34%), Positives = 34/76 (44%), Gaps = 19/76 (25%)
Frame = -2

Query: 303 DIVDRWLQGLLSGDPDVIAEVYSIRSASFNRQ-------------------ELRRLVRDI 181
DI RW GL++ D DV EVYS+ S F+RQ ELR+LVR +
Sbjct: 501 DIATRWSDGLINKDIDVTNEVYSVXSVEFDRQLHFLFKSSELDDFLSLVREELRKLVRKV 560

Query: 180 LKSENRTYKGSAEDDV 133
+ E+DV
Sbjct: 561 HSIQGHQAIIKEEEDV 576