BP916941
Clone id YMU001_000093_G11
Library
Length 543
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000093_G11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CACTAAAAGAAAGCATTCTCTCCACTGACGGAGCATGAGGCATGTTCATGAAGATGGAGT
TGCTGAAAAAGGCAATGCGCCTTTTTGCATCTAGATTTTTTGGGACATTGTTCATGGCTA
CTTTGGTGCTTAGGGTAGTGCTCAGCCTCCGCATTCTGCGATAAAAAGCTTTATCCTTCT
CACAATGGGGCACCTGTACAGCACGCACAAACAAGAGCTCGTCGCGGCCTATGCCTAGGC
CGGCATGCCTCAAAGACTCCACCTCATTCTTGGCATGAAACATGTCTCTCATCACTGCAT
CATACAGATTCTGTAGGGCAACAACCACCTCTTTCCTGGTAGCCTTCTCTAGTAGAACTA
TTACCAGTCCCGACACTCTTGCATGCACCTCTGACAATGCACTCACCTTAAACCTTTGAC
AAAACGTGCCTTCCTCGTATTTCTTTTTCAATCTCCGTGAAAATGTAGTCTACAATGTCA
TACTCTTTGCTCCTCTCATTCAGAATTCTCTTGAGCAGGTGCTTCACAGTATCATAACAC
TCT
■■Homology search results ■■ -
sp_hit_id Q9ZT82
Definition sp|Q9ZT82|CALSC_ARATH Callose synthase 12 OS=Arabidopsis thaliana
Align length 160
Score (bit) 96.7
E-value 7.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916941|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_G11.
(543 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9ZT82|CALSC_ARATH Callose synthase 12 OS=Arabidopsis thalian... 97 7e-20
sp|Q9S9U0|CALSB_ARATH Callose synthase 11 OS=Arabidopsis thalian... 84 4e-16
sp|Q3B724|CALS5_ARATH Callose synthase 5 OS=Arabidopsis thaliana... 70 9e-12
sp|Q9AUE0|CALS1_ARATH Callose synthase 1 OS=Arabidopsis thaliana... 70 9e-12
sp|Q9SL03|CALS2_ARATH Callose synthase 2 OS=Arabidopsis thaliana... 69 1e-11
sp|Q9LUD7|CALS8_ARATH Putative callose synthase 8 OS=Arabidopsis... 67 4e-11
sp|Q9LXT9|CALS3_ARATH Callose synthase 3 OS=Arabidopsis thaliana... 67 6e-11
sp|Q9SFU6|CALS9_ARATH Callose synthase 9 OS=Arabidopsis thaliana... 61 4e-09
sp|Q9LYS6|CALS6_ARATH Putative callose synthase 6 OS=Arabidopsis... 60 7e-09
sp|Q9SHJ3|CALS7_ARATH Callose synthase 7 OS=Arabidopsis thaliana... 55 2e-07
sp|Q9LTG5|CALS4_ARATH Callose synthase 4 OS=Arabidopsis thaliana... 55 2e-07
sp|Q9SJM0|CALSA_ARATH Callose synthase 10 OS=Arabidopsis thalian... 54 5e-07
sp|Q6ZRF8|RN207_HUMAN RING finger protein 207 OS=Homo sapiens GN... 35 0.31
sp|Q3V3A7|RN207_MOUSE RING finger protein 207 OS=Mus musculus GN... 32 1.5
sp|Q6YXY2|HACL1_ORYSJ Probable histone acetyltransferase HAC-lik... 32 2.6
sp|Q10287|BGS1_SCHPO 1,3-beta-glucan synthase component bgs1 OS=... 32 2.6
sp|Q9P377|BGS3_SCHPO 1,3-beta-glucan synthase component bgs3 OS=... 30 5.8
sp|Q91WF7|SAC3_MOUSE SAC domain-containing protein 3 OS=Mus musc... 30 7.6
sp|Q9ESP7|ATS4_RAT A disintegrin and metalloproteinase with thro... 30 7.6
sp|P98167|SSPO_BOVIN SCO-spondin OS=Bos taurus GN=SSPO PE=2 SV=2 30 7.6
sp|P09344|HEMA_I85A6 Hemagglutinin OS=Influenza A virus (strain ... 30 7.6
sp|P09343|HEMA_I85A3 Hemagglutinin OS=Influenza A virus (strain ... 30 7.6
sp|P03456|HEMA_I68A3 Hemagglutinin OS=Influenza A virus (strain ... 30 7.6
sp|P03459|HEMA_I34A0 Hemagglutinin OS=Influenza A virus (strain ... 30 7.6
sp|P36346|HEMA_I000F Hemagglutinin OS=Influenza A virus (strain ... 30 7.6
sp|A8G6Y4|RPOC2_PROM2 DNA-directed RNA polymerase subunit beta' ... 30 9.9
sp|Q1BBA3|MBTN_MYCSS Acyl-[acyl-carrier-protein] dehydrogenase m... 30 9.9

>sp|Q9ZT82|CALSC_ARATH Callose synthase 12 OS=Arabidopsis thaliana
GN=CALS12 PE=2 SV=1
Length = 1780

Score = 96.7 bits (239), Expect = 7e-20
Identities = 60/160 (37%), Positives = 91/160 (56%), Gaps = 4/160 (2%)
Frame = -3

Query: 469 TTFSRRLKKKYEEGTFCQRFKVSALSEVHARVSGLV-IVLLEKATRKEVVVALQNLYDAV 293
T F + + + + F + F+V L +++ + LV +V E+ VV LQ+LY+
Sbjct: 754 TVFFQIINQSIQSEQFTKTFRVDLLPKIYETLQKLVGLVNDEETDSGRVVNVLQSLYEIA 813

Query: 292 MRDMFHAKNEVESLRHAGLGIGRD---ELLFVRAVQVPHCEKDKAFYXXXXXXXXXXXTK 122
R F K E L + GL RD +LLF A+++P + FY ++
Sbjct: 814 TRQFFIEKKTTEQLSNEGL-TPRDPASKLLFQNAIRLPDASNED-FYRQVRRLHTILTSR 871

Query: 121 VAMNNVPKNLDAKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
+M++VP NL+A+RRIAFFSNS+FMNMPHAP VE+M++FS
Sbjct: 872 DSMHSVPVNLEARRRIAFFSNSLFMNMPHAPQVEKMMAFS 911



Score = 30.8 bits (68), Expect = 4.5
Identities = 13/36 (36%), Positives = 22/36 (61%)
Frame = -2

Query: 542 ECYDTVKHLLKRILNERSKEYDIVDYIFTEIEKEIR 435
E YD++KHLL I+ ++E+ I+ F I + I+
Sbjct: 730 EAYDSIKHLLLSIIKVDTEEHSIITVFFQIINQSIQ 765


>sp|Q9S9U0|CALSB_ARATH Callose synthase 11 OS=Arabidopsis thaliana
GN=CALS11 PE=2 SV=1
Length = 1768

Score = 84.0 bits (206), Expect = 4e-16
Identities = 51/155 (32%), Positives = 82/155 (52%), Gaps = 5/155 (3%)
Frame = -3

Query: 451 LKKKYEEGTFCQRFKVSALSEVHARVSGLVIVLLEKATRK-EVVVALQNLYDAVMRDMFH 275
+ + E + +K++ L +H ++ L+ L++ + +V LQ LY+ +
Sbjct: 752 IDENVENEKITEVYKLTVLLRIHEKLISLLERLMDPEKKVFRIVNILQALYELCAWEFPK 811

Query: 274 AKNEVESLRHAGLGI----GRDELLFVRAVQVPHCEKDKAFYXXXXXXXXXXXTKVAMNN 107
+ LR GL ELLFV A+ +P + D FY ++ M+N
Sbjct: 812 TRRSTPQLRQLGLAPISLEADTELLFVNAINLPPLD-DVVFYRQIRRVHTILTSRDPMHN 870

Query: 106 VPKNLDAKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
VPKN++A+ R+AFFSNS+FM MP APSVE+M++FS
Sbjct: 871 VPKNIEARERLAFFSNSLFMTMPQAPSVEKMMAFS 905


>sp|Q3B724|CALS5_ARATH Callose synthase 5 OS=Arabidopsis thaliana
GN=CALS5 PE=1 SV=1
Length = 1923

Score = 69.7 bits (169), Expect = 9e-12
Identities = 51/159 (32%), Positives = 79/159 (49%), Gaps = 7/159 (4%)
Frame = -3

Query: 457 RRLKKKYEEGTFCQRFKVSALSEVHARVSGLVIVL--LEKATRKEVVVALQNLYDAVMRD 284
+ ++ + +F F+++ L + ++ LV +L + A R VV+ LQ++ + V RD
Sbjct: 918 KEVESNISKNSFLSNFRMAPLPALCSKFVELVGILKNADPAKRDTVVLLLQDMLEVVTRD 977

Query: 283 MFHAKN-EVESLRHAGLGIGRDELLFVRAVQVPHC----EKDKAFYXXXXXXXXXXXTKV 119
M +N E+ L H GR LF P ++ K
Sbjct: 978 MMQNENRELVELGHTNKESGRQ--LFAGTDAKPAILFPPVATAQWHEQISRLHLLLTVKE 1035

Query: 118 AMNNVPKNLDAKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
+ +VP NL+A+RRIAFF+NS+FM+MP AP V MLSFS
Sbjct: 1036 SAMDVPTNLEAQRRIAFFTNSLFMDMPRAPRVRNMLSFS 1074


>sp|Q9AUE0|CALS1_ARATH Callose synthase 1 OS=Arabidopsis thaliana
GN=CALS1 PE=1 SV=2
Length = 1950

Score = 69.7 bits (169), Expect = 9e-12
Identities = 48/163 (29%), Positives = 83/163 (50%), Gaps = 12/163 (7%)
Frame = -3

Query: 454 RLKKKYEEGTFCQRFKVSALSEVHARVSGLVIVLLE--KATRKEVVVALQNLYDAVMRDM 281
++ + E+ T +SAL +++ + L+ LLE + + ++V+ L N+ + V RD+
Sbjct: 922 KIDEHIEKETLITELNLSALPDLYGQFVRLIEYLLENREEDKDQIVIVLLNMLELVTRDI 981

Query: 280 FHAKNEVESL---RHAGLGIGRDELL-------FVRAVQVPHCEKDKAFYXXXXXXXXXX 131
+ EV SL H G + D + + ++ P + +A+
Sbjct: 982 M--EEEVPSLLETAHNGSYVKYDVMTPLHQQRKYFSQLRFPVYSQTEAWKEKIKRLHLLL 1039

Query: 130 XTKVAMNNVPKNLDAKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
K + +VP NL+A+RR+ FFSNS+FM+MP AP + MLSFS
Sbjct: 1040 TVKESAMDVPSNLEARRRLTFFSNSLFMDMPPAPKIRNMLSFS 1082


>sp|Q9SL03|CALS2_ARATH Callose synthase 2 OS=Arabidopsis thaliana
GN=CALS2 PE=2 SV=2
Length = 1951

Score = 69.3 bits (168), Expect = 1e-11
Identities = 47/163 (28%), Positives = 82/163 (50%), Gaps = 12/163 (7%)
Frame = -3

Query: 454 RLKKKYEEGTFCQRFKVSALSEVHARVSGLVIVLLE--KATRKEVVVALQNLYDAVMRDM 281
R+ + E+ T + +SAL +++ + L+ L+E + + ++V+ L N+ + V RD+
Sbjct: 923 RIDEHIEKETLIKDLNLSALPDLYGQFVRLIEYLMENREEDKDQIVIVLLNMLEVVTRDI 982

Query: 280 FHAKNEVESL---RHAGLGIGRDELL-------FVRAVQVPHCEKDKAFYXXXXXXXXXX 131
EV S+ H G + D + + ++ P + +A+
Sbjct: 983 MD--EEVPSMLESTHNGTYVKYDVMTPLHQQRKYFSQLRFPVYSQTEAWKEKIKRLHLLL 1040

Query: 130 XTKVAMNNVPKNLDAKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
K + +VP NL+A+RR+ FFSNS+FM MP AP + MLSFS
Sbjct: 1041 TVKESAMDVPSNLEARRRLTFFSNSLFMEMPDAPKIRNMLSFS 1083


>sp|Q9LUD7|CALS8_ARATH Putative callose synthase 8 OS=Arabidopsis
thaliana GN=CALS8 PE=3 SV=2
Length = 1976

Score = 67.4 bits (163), Expect = 4e-11
Identities = 44/174 (25%), Positives = 83/174 (47%), Gaps = 24/174 (13%)
Frame = -3

Query: 451 LKKKYEEGTFCQRFKVSALSEVHARVSGLVIVLLEKATRK-----------EVVVALQNL 305
+++ + + + FK++ L +H + LV +L+E + + ++V ALQ++
Sbjct: 968 IEESIRQSSLLEEFKMAELPALHDKCIELVQLLVEGSAEQLQVEKSEELHGKLVKALQDI 1027

Query: 304 YDAVMRDMFHAKNEVESLRHAGLGIGRDELLFVRAVQVPHCEK-------------DKAF 164
++ V DM + + L + G G D +F+R ++ E +
Sbjct: 1028 FELVTNDMMVHGDRILDLLQSREGSGEDTGIFMRVIEPQLFESYGEWRCIHFPLPDSASL 1087

Query: 163 YXXXXXXXXXXXTKVAMNNVPKNLDAKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
K + ++P+NLDA+RR++FF+ S+FM+MP AP V M+SFS
Sbjct: 1088 SEQIQRFLLLLTVKDSAMDIPENLDARRRLSFFATSLFMDMPDAPKVRNMMSFS 1141


>sp|Q9LXT9|CALS3_ARATH Callose synthase 3 OS=Arabidopsis thaliana
GN=CALS3 PE=2 SV=2
Length = 1964

Score = 67.0 bits (162), Expect = 6e-11
Identities = 54/191 (28%), Positives = 88/191 (46%), Gaps = 22/191 (11%)
Frame = -3

Query: 508 EF*MRGAKSMTL*TTFSRRLKKKYEEGTFCQRFKVSALSEVHARVSGLVIVLLE--KATR 335
+F ++G + + + K + G Q +K+SAL ++ L+ LL+ + R
Sbjct: 910 KFVVQGNREKEVIEIIFAEVDKHIDTGDLIQEYKMSALPSLYDHFVKLIKYLLDNKEEDR 969

Query: 334 KEVVVALQNLYDAVMRDMFHAKNEVESLR-----------------HAGL-GIGRDELLF 209
VV+ Q++ + V RD+ + L H G+ + + LF
Sbjct: 970 DHVVILFQDMLEVVTRDIMMEDYNISRLATFYRTAMACHSSHGGTWHGGMIPLEQQYQLF 1029

Query: 208 VR--AVQVPHCEKDKAFYXXXXXXXXXXXTKVAMNNVPKNLDAKRRIAFFSNSIFMNMPH 35
A++ P +A+ TK + +VP NL+A+RRI+FFSNS+FM+MP
Sbjct: 1030 ASSGAIRFPIEPVTEAWKEKIKRIYLLLTTKESAMDVPSNLEARRRISFFSNSLFMDMPM 1089

Query: 34 APSVERMLSFS 2
AP V MLSFS
Sbjct: 1090 APKVRNMLSFS 1100


>sp|Q9SFU6|CALS9_ARATH Callose synthase 9 OS=Arabidopsis thaliana
GN=CALS9 PE=2 SV=1
Length = 1931

Score = 60.8 bits (146), Expect = 4e-09
Identities = 49/144 (34%), Positives = 74/144 (51%), Gaps = 7/144 (4%)
Frame = -3

Query: 412 FKVSALSEVHARVSGLVIVLLEKAT---RKEVVVALQNLYDAVMRDM--FHAKNEVES-- 254
F+++ LS V RV+ L+ +L E T K + ALQ+LYD + D+ F+ + E+
Sbjct: 962 FQLNKLSLVITRVTALLGILKENETPEHAKGAIKALQDLYDVMRLDILTFNMRGHYETWN 1021

Query: 253 LRHAGLGIGRDELLFVRAVQVPHCEKDKAFYXXXXXXXXXXXTKVAMNNVPKNLDAKRRI 74
L GR LF + KD K + +VP+NL+A+RR+
Sbjct: 1022 LLTQAWNEGR---LFTKL----KWPKDPELKALVKRLYSLFTIKDSAAHVPRNLEARRRL 1074

Query: 73 AFFSNSIFMNMPHAPSVERMLSFS 2
FF+NS+FM++P SV +MLSFS
Sbjct: 1075 QFFTNSLFMDVPPPKSVRKMLSFS 1098


>sp|Q9LYS6|CALS6_ARATH Putative callose synthase 6 OS=Arabidopsis
thaliana GN=CALS6 PE=3 SV=2
Length = 1921

Score = 60.1 bits (144), Expect = 7e-09
Identities = 39/151 (25%), Positives = 75/151 (49%), Gaps = 6/151 (3%)
Frame = -3

Query: 436 EEGTFCQRFKVSALSEVHARVSGLVIVLL-----EKATRKEVVVALQNLYDAVMRDMFHA 272
++ F F++S L + ++ + +LL + + +++ Q++ + + +D+
Sbjct: 924 QQQRFIYEFRMSGLPLLSDKLEKFLSILLSDYEDQGTYKSQLINVFQDVIEIITQDLLVN 983

Query: 271 KNEVESLRHAGLGIGRDELLFVRAVQVP-HCEKDKAFYXXXXXXXXXXXTKVAMNNVPKN 95
+E+ ++E R ++ H +D+ + K + NVP+N
Sbjct: 984 GHEILERARVHSPDIKNEKKEQRFEKINIHLVRDRCWREKVIRLHLLLSVKESAINVPQN 1043

Query: 94 LDAKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
L+A+RRI FF+NS+FMNMP AP + MLSFS
Sbjct: 1044 LEARRRITFFANSLFMNMPSAPRIRDMLSFS 1074


>sp|Q9SHJ3|CALS7_ARATH Callose synthase 7 OS=Arabidopsis thaliana
GN=CALS7 PE=2 SV=2
Length = 1933

Score = 55.5 bits (132), Expect = 2e-07
Identities = 36/150 (24%), Positives = 75/150 (50%), Gaps = 5/150 (3%)
Frame = -3

Query: 436 EEGTFCQRFKVSALSEVHARVSGLVIVLL----EKATRKEVVVALQNLYDAVMRDMFHAK 269
++ F F+++ + + ++ + +LL E + +++ LQ++ + + +D+
Sbjct: 935 QQHRFLSEFRMTGMPLLSDKLEKFLKILLSDYEEDDYKSQIINVLQDIIEIITQDVMVNG 994

Query: 268 NEVESLRHAGLGIGRDELLFVRAVQVP-HCEKDKAFYXXXXXXXXXXXTKVAMNNVPKNL 92
+E+ H G + R ++ ++ ++ K + N+P++L
Sbjct: 995 HEILERAHLQSGDIESDKKEQRFEKIDLSLTQNISWREKVVRLLLLLTVKESAINIPQSL 1054

Query: 91 DAKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
+A+RR+ FF+NS+FMNMP AP V MLSFS
Sbjct: 1055 EARRRMTFFANSLFMNMPDAPRVRDMLSFS 1084


tr_hit_id Q8S1X0
Definition tr|Q8S1X0|Q8S1X0_ORYSJ cDNA clone:J013036H01, full insert sequence OS=Oryza sativa subsp. japonica
Align length 149
Score (bit) 102.0
E-value 1.0e-24
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916941|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_G11.
(543 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8S1X0|Q8S1X0_ORYSJ cDNA clone:J013036H01, full insert sequen... 102 1e-24
tr|Q5JMM8|Q5JMM8_ORYSJ Putative callose synthase 1 catalytic sub... 102 1e-24
tr|A2ZXX8|A2ZXX8_ORYSJ Putative uncharacterized protein OS=Oryza... 102 1e-24
tr|B8A9R1|B8A9R1_ORYSI Putative uncharacterized protein OS=Oryza... 102 1e-24
tr|A9TZ19|A9TZ19_PHYPA Predicted protein OS=Physcomitrella paten... 93 6e-23
tr|B8A790|B8A790_ORYSI Putative uncharacterized protein OS=Oryza... 108 2e-22
tr|Q8W0J2|Q8W0J2_ORYSJ 1,3-beta-glucan synthase component-like O... 107 3e-22
tr|A2ZWF2|A2ZWF2_ORYSJ Putative uncharacterized protein OS=Oryza... 107 3e-22
tr|A7R403|A7R403_VITVI Chromosome undetermined scaffold_596, who... 101 3e-20
tr|A9RK32|A9RK32_PHYPA Predicted protein OS=Physcomitrella paten... 86 2e-15
tr|A9SCP5|A9SCP5_PHYPA Predicted protein OS=Physcomitrella paten... 79 2e-13
tr|A7P003|A7P003_VITVI Chromosome chr6 scaffold_3, whole genome ... 77 8e-13
tr|A9TBI0|A9TBI0_PHYPA Predicted protein OS=Physcomitrella paten... 72 2e-12
tr|A7QB54|A7QB54_VITVI Chromosome chr4 scaffold_73, whole genome... 73 8e-12
tr|Q5SMM3|Q5SMM3_ORYSJ Putative callose synthase 1 catalytic sub... 72 1e-11
tr|Q0DE26|Q0DE26_ORYSJ Os06g0182300 protein (Fragment) OS=Oryza ... 72 1e-11
tr|A3B909|A3B909_ORYSJ Putative uncharacterized protein OS=Oryza... 72 1e-11
tr|B8B3H8|B8B3H8_ORYSI Putative uncharacterized protein OS=Oryza... 72 2e-11
tr|A5AKI1|A5AKI1_VITVI Putative uncharacterized protein OS=Vitis... 72 2e-11
tr|A2Q2S3|A2Q2S3_MEDTR Glycosyl transferase, family 48 (Fragment... 71 4e-11
tr|Q5Z5B8|Q5Z5B8_ORYSJ Putative callose synthase 1 catalytic sub... 70 9e-11
tr|Q0D9B3|Q0D9B3_ORYSJ Os06g0728800 protein OS=Oryza sativa subs... 70 9e-11
tr|B8B2Y5|B8B2Y5_ORYSI Putative uncharacterized protein OS=Oryza... 70 9e-11
tr|A3BFM0|A3BFM0_ORYSJ Putative uncharacterized protein OS=Oryza... 70 9e-11
tr|Q93XQ3|Q93XQ3_NICAL Putative beta-1,3-glucan synthase OS=Nico... 66 1e-09
tr|Q9XEG1|Q9XEG1_GOSHI Putative callose synthase catalytic subun... 63 9e-09
tr|Q6K963|Q6K963_ORYSJ Putative callose synthase 1 catalytic sub... 63 1e-08
tr|A7QR97|A7QR97_VITVI Chromosome chr13 scaffold_149, whole geno... 63 1e-08
tr|A5B716|A5B716_VITVI Putative uncharacterized protein OS=Vitis... 63 1e-08
tr|A3AD16|A3AD16_ORYSJ Putative uncharacterized protein OS=Oryza... 63 1e-08

>tr|Q8S1X0|Q8S1X0_ORYSJ cDNA clone:J013036H01, full insert sequence
OS=Oryza sativa subsp. japonica GN=P0503C12.17-1 PE=2
SV=1
Length = 1790

Score = 102 bits (255), Expect(2) = 1e-24
Identities = 58/149 (38%), Positives = 91/149 (61%), Gaps = 4/149 (2%)
Frame = -3

Query: 436 EEGTFCQRFKVSALSEVHARVSGLVI-VLLEKATRKEVVVALQNLYDAVMRDMFHAKNEV 260
E G F + ++++ L ++H V LV +LL+ + ++V LQ+LYD + D K +
Sbjct: 774 EYGKFTEEYRLTLLPQIHKYVISLVEQLLLKDKDQIKIVRTLQDLYDLAVHDFPKIKKDF 833

Query: 259 ESLRHAGLGIGR---DELLFVRAVQVPHCEKDKAFYXXXXXXXXXXXTKVAMNNVPKNLD 89
E LR GL + R +LLF A++ P + D +FY ++ +M++VPKN +
Sbjct: 834 EQLRREGLALSRPTESQLLFQDAIKCPD-DNDVSFYKQVRRLHTILTSRDSMDDVPKNPE 892

Query: 88 AKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
A+RRI FFSNS+FMNMP AP+V+RM++FS
Sbjct: 893 ARRRITFFSNSLFMNMPRAPTVQRMMAFS 921



Score = 33.5 bits (75), Expect(2) = 1e-24
Identities = 13/28 (46%), Positives = 21/28 (75%)
Frame = -2

Query: 542 ECYDTVKHLLKRILNERSKEYDIVDYIF 459
E YD+++HLL I+ ER+ E+ IV+ +F
Sbjct: 739 EAYDSIRHLLLEIIKERTNEHIIVNQLF 766


>tr|Q5JMM8|Q5JMM8_ORYSJ Putative callose synthase 1 catalytic subunit
OS=Oryza sativa subsp. japonica GN=P0503C12.17-2 PE=4
SV=1
Length = 1618

Score = 102 bits (255), Expect(2) = 1e-24
Identities = 58/149 (38%), Positives = 91/149 (61%), Gaps = 4/149 (2%)
Frame = -3

Query: 436 EEGTFCQRFKVSALSEVHARVSGLVI-VLLEKATRKEVVVALQNLYDAVMRDMFHAKNEV 260
E G F + ++++ L ++H V LV +LL+ + ++V LQ+LYD + D K +
Sbjct: 602 EYGKFTEEYRLTLLPQIHKYVISLVEQLLLKDKDQIKIVRTLQDLYDLAVHDFPKIKKDF 661

Query: 259 ESLRHAGLGIGR---DELLFVRAVQVPHCEKDKAFYXXXXXXXXXXXTKVAMNNVPKNLD 89
E LR GL + R +LLF A++ P + D +FY ++ +M++VPKN +
Sbjct: 662 EQLRREGLALSRPTESQLLFQDAIKCPD-DNDVSFYKQVRRLHTILTSRDSMDDVPKNPE 720

Query: 88 AKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
A+RRI FFSNS+FMNMP AP+V+RM++FS
Sbjct: 721 ARRRITFFSNSLFMNMPRAPTVQRMMAFS 749



Score = 33.5 bits (75), Expect(2) = 1e-24
Identities = 13/28 (46%), Positives = 21/28 (75%)
Frame = -2

Query: 542 ECYDTVKHLLKRILNERSKEYDIVDYIF 459
E YD+++HLL I+ ER+ E+ IV+ +F
Sbjct: 567 EAYDSIRHLLLEIIKERTNEHIIVNQLF 594


>tr|A2ZXX8|A2ZXX8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_003400 PE=4 SV=1
Length = 1533

Score = 102 bits (255), Expect(2) = 1e-24
Identities = 58/149 (38%), Positives = 91/149 (61%), Gaps = 4/149 (2%)
Frame = -3

Query: 436 EEGTFCQRFKVSALSEVHARVSGLVI-VLLEKATRKEVVVALQNLYDAVMRDMFHAKNEV 260
E G F + ++++ L ++H V LV +LL+ + ++V LQ+LYD + D K +
Sbjct: 774 EYGKFTEEYRLTLLPQIHKYVISLVEQLLLKDKDQIKIVRTLQDLYDLAVHDFPKIKKDF 833

Query: 259 ESLRHAGLGIGR---DELLFVRAVQVPHCEKDKAFYXXXXXXXXXXXTKVAMNNVPKNLD 89
E LR GL + R +LLF A++ P + D +FY ++ +M++VPKN +
Sbjct: 834 EQLRREGLALSRPTESQLLFQDAIKCPD-DNDVSFYKQVRRLHTILTSRDSMDDVPKNPE 892

Query: 88 AKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
A+RRI FFSNS+FMNMP AP+V+RM++FS
Sbjct: 893 ARRRITFFSNSLFMNMPRAPTVQRMMAFS 921



Score = 33.5 bits (75), Expect(2) = 1e-24
Identities = 13/28 (46%), Positives = 21/28 (75%)
Frame = -2

Query: 542 ECYDTVKHLLKRILNERSKEYDIVDYIF 459
E YD+++HLL I+ ER+ E+ IV+ +F
Sbjct: 739 EAYDSIRHLLLEIIKERTNEHIIVNQLF 766


>tr|B8A9R1|B8A9R1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_03775 PE=4 SV=1
Length = 1207

Score = 102 bits (254), Expect(2) = 1e-24
Identities = 58/149 (38%), Positives = 91/149 (61%), Gaps = 4/149 (2%)
Frame = -3

Query: 436 EEGTFCQRFKVSALSEVHARVSGLVI-VLLEKATRKEVVVALQNLYDAVMRDMFHAKNEV 260
E G F + ++++ L ++H V LV +LL+ + ++V LQ+LYD + D K +
Sbjct: 777 EYGKFTEEYRLTLLPQIHKYVISLVEQLLLKDKDQIKIVRTLQDLYDLAVHDFPKIKKDF 836

Query: 259 ESLRHAGLGIGR---DELLFVRAVQVPHCEKDKAFYXXXXXXXXXXXTKVAMNNVPKNLD 89
E LR GL + R +LLF A++ P + D +FY ++ +M++VPKN +
Sbjct: 837 EQLRREGLALSRPTESQLLFQDAIKCPD-DDDVSFYKQVRRLHTILTSRDSMDDVPKNPE 895

Query: 88 AKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
A+RRI FFSNS+FMNMP AP+V+RM++FS
Sbjct: 896 ARRRITFFSNSLFMNMPRAPTVQRMMAFS 924



Score = 33.5 bits (75), Expect(2) = 1e-24
Identities = 13/28 (46%), Positives = 21/28 (75%)
Frame = -2

Query: 542 ECYDTVKHLLKRILNERSKEYDIVDYIF 459
E YD+++HLL I+ ER+ E+ IV+ +F
Sbjct: 742 EAYDSIRHLLLEIIKERTNEHIIVNQLF 769


>tr|A9TZ19|A9TZ19_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_199665 PE=4 SV=1
Length = 1758

Score = 93.2 bits (230), Expect(2) = 6e-23
Identities = 59/146 (40%), Positives = 81/146 (55%), Gaps = 5/146 (3%)
Frame = -3

Query: 424 FCQRFKVSALSEVHARVSGLVIVLLEKATR---KEVVVALQNLYDAVMRDMFHAKNEVES 254
F F + + VH RV L+ VL+ K T ++VV ALQNLY+ V+ D + E
Sbjct: 755 FTTSFVLQKILIVHDRVVKLIAVLMTKPTGGNIRKVVDALQNLYEDVVEDFIRDSSVKEI 814

Query: 253 LR--HAGLGIGRDELLFVRAVQVPHCEKDKAFYXXXXXXXXXXXTKVAMNNVPKNLDAKR 80
+R H +D LF+ AV +P + D F+ T+ NVPK L+A+R
Sbjct: 815 IRGQHLSTATNKDTELFMNAVTLPS-DDDAPFFKHLSRIHTTLSTREPFLNVPKGLEARR 873

Query: 79 RIAFFSNSIFMNMPHAPSVERMLSFS 2
RI+FFSNS+FM MP AP V+RML+FS
Sbjct: 874 RISFFSNSLFMTMPRAPQVDRMLAFS 899



Score = 37.4 bits (85), Expect(2) = 6e-23
Identities = 16/36 (44%), Positives = 27/36 (75%), Gaps = 1/36 (2%)
Frame = -2

Query: 542 ECYDTVKH-LLKRILNERSKEYDIVDYIFTEIEKEI 438
ECY+++KH LL+R+L S+E+ I++ +F EI+ I
Sbjct: 715 ECYESIKHILLRRLLKVDSQEHKIIESVFKEIDASI 750


>tr|B8A790|B8A790_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_03222 PE=4 SV=1
Length = 1705

Score = 108 bits (269), Expect = 2e-22
Identities = 66/159 (41%), Positives = 92/159 (57%), Gaps = 3/159 (1%)
Frame = -3

Query: 469 TTFSRRLKKKYEEGTFCQRFKVSALSEVHARVSGLVIVLL--EKATRKEVVVALQNLYDA 296
T R + F +K+S L VHA++ ++ +LL EK K +V ALQ LYD
Sbjct: 735 TQLFREFDESMSMEKFTVEYKMSVLPNVHAKLVAILSLLLKPEKDITK-IVNALQTLYDV 793

Query: 295 VMRDMFHAKNEVESLRHAGLGIGRD-ELLFVRAVQVPHCEKDKAFYXXXXXXXXXXXTKV 119
++RD K +E LR+ GL R LLFV + +P EK+ FY ++
Sbjct: 794 LIRDFQAEKRSMEQLRNEGLAQSRPTRLLFVDTIVLPDEEKNPTFYKQVRRMHTILTSRD 853

Query: 118 AMNNVPKNLDAKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
+M NVPKNL+A+RRIAFFSNS+FMN+P A VE+M++FS
Sbjct: 854 SMINVPKNLEARRRIAFFSNSLFMNIPRATQVEKMMAFS 892


>tr|Q8W0J2|Q8W0J2_ORYSJ 1,3-beta-glucan synthase component-like
OS=Oryza sativa subsp. japonica GN=P0007F06.13 PE=4 SV=1
Length = 1769

Score = 107 bits (268), Expect = 3e-22
Identities = 64/144 (44%), Positives = 89/144 (61%), Gaps = 3/144 (2%)
Frame = -3

Query: 424 FCQRFKVSALSEVHARVSGLVIVLL--EKATRKEVVVALQNLYDAVMRDMFHAKNEVESL 251
F +K+S L VHA++ ++ +LL EK K +V ALQ LYD ++RD K +E L
Sbjct: 750 FTVEYKMSVLPNVHAKLVAILSLLLKPEKDITK-IVNALQTLYDVLIRDFQAEKRSMEQL 808

Query: 250 RHAGLGIGRD-ELLFVRAVQVPHCEKDKAFYXXXXXXXXXXXTKVAMNNVPKNLDAKRRI 74
R+ GL R LLFV + +P EK+ FY ++ +M NVPKNL+A+RRI
Sbjct: 809 RNEGLAQSRPTRLLFVDTIVLPDEEKNPTFYKQVRRMHTILTSRDSMINVPKNLEARRRI 868

Query: 73 AFFSNSIFMNMPHAPSVERMLSFS 2
AFFSNS+FMN+P A VE+M++FS
Sbjct: 869 AFFSNSLFMNIPRATQVEKMMAFS 892


>tr|A2ZWF2|A2ZWF2_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_002874 PE=4 SV=1
Length = 1711

Score = 107 bits (268), Expect = 3e-22
Identities = 64/144 (44%), Positives = 89/144 (61%), Gaps = 3/144 (2%)
Frame = -3

Query: 424 FCQRFKVSALSEVHARVSGLVIVLL--EKATRKEVVVALQNLYDAVMRDMFHAKNEVESL 251
F +K+S L VHA++ ++ +LL EK K +V ALQ LYD ++RD K +E L
Sbjct: 692 FTVEYKMSVLPNVHAKLVAILSLLLKPEKDITK-IVNALQTLYDVLIRDFQAEKRSMEQL 750

Query: 250 RHAGLGIGRD-ELLFVRAVQVPHCEKDKAFYXXXXXXXXXXXTKVAMNNVPKNLDAKRRI 74
R+ GL R LLFV + +P EK+ FY ++ +M NVPKNL+A+RRI
Sbjct: 751 RNEGLAQSRPTRLLFVDTIVLPDEEKNPTFYKQVRRMHTILTSRDSMINVPKNLEARRRI 810

Query: 73 AFFSNSIFMNMPHAPSVERMLSFS 2
AFFSNS+FMN+P A VE+M++FS
Sbjct: 811 AFFSNSLFMNIPRATQVEKMMAFS 834


>tr|A7R403|A7R403_VITVI Chromosome undetermined scaffold_596, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00004069001 PE=4 SV=1
Length = 1891

Score = 101 bits (251), Expect = 3e-20
Identities = 61/169 (36%), Positives = 95/169 (56%), Gaps = 5/169 (2%)
Frame = -3

Query: 493 GAKSMTL*TTFSRRLKKKYEEGTFCQRFKVSALSEVHARVSGLVIVLL-EKATRKEVVVA 317
G++ ++ F + +++ E G F + +K++ L ++HA++ L+ +LL K +VV
Sbjct: 742 GSEENSIVANFFQEIERYIEIGKFTEMYKMTLLPQIHAKLISLIKLLLGPKKDHSKVVNV 801

Query: 316 LQNLYDAVMRDMFHAKNEVESLRHAGLG----IGRDELLFVRAVQVPHCEKDKAFYXXXX 149
LQ LY+ +R+ K + LR GL LLF AV+ P E +
Sbjct: 802 LQALYELCVREFPKVKRSIVQLRQEGLAPLSPAADAGLLFENAVEFPDAEDARHL----R 857

Query: 148 XXXXXXXTKVAMNNVPKNLDAKRRIAFFSNSIFMNMPHAPSVERMLSFS 2
++ +M+NVP NL+A+RRIAFFSNS+FMNMPHAP VE+M+ FS
Sbjct: 858 RLQTILTSRDSMHNVPTNLEARRRIAFFSNSLFMNMPHAPRVEKMVPFS 906


>tr|A9RK32|A9RK32_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_175718 PE=4 SV=1
Length = 1768

Score = 85.5 bits (210), Expect = 2e-15
Identities = 58/147 (39%), Positives = 82/147 (55%), Gaps = 6/147 (4%)
Frame = -3

Query: 424 FCQRFKVSALSEVHARVSGLVIVLLEKATRK---EVVVALQNLYDAVMRDMF---HAKNE 263
F + FK+ L E+HARV L+ LL + K +VV LQNLY+ ++ D H E
Sbjct: 747 FTETFKLPELMEIHARVVELISFLLTRPAEKHKQKVVKDLQNLYEGLLHDFPLQPHIFLE 806

Query: 262 VESLRHAGLGIGRDELLFVRAVQVPHCEKDKAFYXXXXXXXXXXXTKVAMNNVPKNLDAK 83
R + + LF+ AV++P + D+ F+ T+ + VPK L+A+
Sbjct: 807 SIKARASYPQNNKGTELFMDAVELPD-KGDEHFFKNLKRLHTTLSTRDPLLYVPKGLEAR 865

Query: 82 RRIAFFSNSIFMNMPHAPSVERMLSFS 2
RRI+FFSNS+FM MP AP VERML+FS
Sbjct: 866 RRISFFSNSLFMTMPRAPQVERMLAFS 892