BP916944
Clone id YMU001_000093_H02
Library
Length 529
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000093_H02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACTCTGTGTGCGCCTGATGCCAGTCACGAAGAATGGAAGTGAATGGAGAGTCTCTCACAG
AAGCCCGGGAGGGGCGCGCATGGCTCTCTCGCATGGGGCAGCAAGGCTCTTATTCCTTTT
TCTCCTTATATTGAAGCTGTTAAGAGGGCTAAAGCCTCACAGCGGTCTCCCACCCTCAAT
CCCAATGGCTATATACTGATGGCTCAAGCTGAGAATATGCTATCATTCGAGCTCGTTCAT
AAAAAAATGAAGTAAGCTTCGAGATATACTTAACAAGTTGGACTCTTGCCTTAGCATCAG
AGAAGCCAAGTTGATTGTGATTGTTTTCTCCCGTAATGAAAATAAAGTCAAGCAATTGGG
TGAAATGCCACATCGTGTGGAAGCCTGTGCAAGATATCTGCTACTGCAAATTCATTTTAT
CGGAAATCAAGCGCAACTGCATGGCGCAAGCCAACTTTTCTACTTCTGATCTAAATCCAC
AGTGCAAGTTTTTGTAACATCTGTTTTCCATAAATAAAGCTTCTATGTC
■■Homology search results ■■ -
sp_hit_id Q4QPH6
Definition sp|Q4QPH6|MIAA_HAEI8 tRNA delta(2)-isopentenylpyrophosphate transferase OS=Haemophilus influenzae (strain 86-028NP)
Align length 81
Score (bit) 37.7
E-value 0.034
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916944|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_H02.
(529 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q4QPH6|MIAA_HAEI8 tRNA delta(2)-isopentenylpyrophosphate tran... 38 0.034
sp|A5UB70|MIAA_HAEIE tRNA delta(2)-isopentenylpyrophosphate tran... 37 0.059
sp|Q07262|1A1C_TOBAC 1-aminocyclopropane-1-carboxylate synthase ... 36 0.13
sp|Q9MB95|1A11_PRUMU 1-aminocyclopropane-1-carboxylate synthase ... 35 0.17
sp|P44495|MIAA_HAEIN tRNA delta(2)-isopentenylpyrophosphate tran... 34 0.38
sp|P18485|1A12_SOLLC 1-aminocyclopropane-1-carboxylate synthase ... 34 0.50
sp|Q6MKR6|SYE_BDEBA Glutamyl-tRNA synthetase OS=Bdellovibrio bac... 33 1.1
sp|Q7U347|MIAA_BLOFL tRNA delta(2)-isopentenylpyrophosphate tran... 33 1.1
sp|P31531|1A1C_SOYBN 1-aminocyclopropane-1-carboxylate synthase ... 33 1.1
sp|Q10DK7|1A11_ORYSJ 1-aminocyclopropane-1-carboxylate synthase ... 33 1.1
sp|A2XLL2|1A11_ORYSI 1-aminocyclopropane-1-carboxylate synthase ... 33 1.1
sp|P23279|1A11_CUCPE 1-aminocyclopropane-1-carboxylate synthase ... 32 2.5
sp|Q06429|1A11_ARATH 1-aminocyclopropane-1-carboxylate synthase-... 32 2.5
sp|Q12K59|KSGA_SHEDO Dimethyladenosine transferase OS=Shewanella... 31 3.2
sp|P23599|1A11_CUCMA 1-aminocyclopropane-1-carboxylate synthase ... 31 3.2
sp|B0UUU6|MIAA_HAES2 tRNA delta(2)-isopentenylpyrophosphate tran... 31 4.2
sp|Q0I462|MIAA_HAES1 tRNA delta(2)-isopentenylpyrophosphate tran... 31 4.2
sp|Q9M2Y8|1A19_ARATH 1-aminocyclopropane-1-carboxylate synthase ... 31 4.2
sp|Q00257|1A12_CUCMA 1-aminocyclopropane-1-carboxylate synthase ... 31 4.2
sp|Q5UQM1|YL421_MIMIV Uncharacterized protein L421 OS=Acanthamoe... 30 5.5
sp|Q9STR4|1A17_ARATH 1-aminocyclopropane-1-carboxylate synthase ... 30 7.2
sp|A1JR24|UXAB_YERE8 Altronate oxidoreductase OS=Yersinia entero... 30 9.4

>sp|Q4QPH6|MIAA_HAEI8 tRNA delta(2)-isopentenylpyrophosphate
transferase OS=Haemophilus influenzae (strain 86-028NP)
GN=miaA PE=3 SV=1
Length = 311

Score = 37.7 bits (86), Expect = 0.034
Identities = 26/81 (32%), Positives = 38/81 (46%)
Frame = -1

Query: 511 MENRCYKNLHCGFRSEVEKLACAMQLRLISDKMNLQ*QISCTGFHTMWHFTQLLDFIFIT 332
+E R +K + GF++EVEKL L + NL I C G+ MW + Q
Sbjct: 207 IEQRFHKMIELGFQAEVEKLYARGDLNI-----NLP-SIRCVGYRQMWEYLQ-------- 252

Query: 331 GENNHNQLGFSDAKARVQLVK 269
G+ +H ++ F A QL K
Sbjct: 253 GDYDHEEMIFRGICATRQLAK 273


>sp|A5UB70|MIAA_HAEIE tRNA delta(2)-isopentenylpyrophosphate
transferase OS=Haemophilus influenzae (strain PittEE)
GN=miaA PE=3 SV=1
Length = 311

Score = 37.0 bits (84), Expect = 0.059
Identities = 26/81 (32%), Positives = 37/81 (45%)
Frame = -1

Query: 511 MENRCYKNLHCGFRSEVEKLACAMQLRLISDKMNLQ*QISCTGFHTMWHFTQLLDFIFIT 332
+E R +K + GF+ EVEKL L + NL I C G+ MW + Q
Sbjct: 207 IEQRFHKMIELGFQEEVEKLYTRGDLNI-----NLP-SIRCVGYRQMWEYLQ-------- 252

Query: 331 GENNHNQLGFSDAKARVQLVK 269
G+ +H ++ F A QL K
Sbjct: 253 GDYDHEEMIFRGICATRQLAK 273


>sp|Q07262|1A1C_TOBAC 1-aminocyclopropane-1-carboxylate synthase
OS=Nicotiana tabacum GN=ACS1 PE=2 SV=1
Length = 491

Score = 35.8 bits (81), Expect = 0.13
Identities = 18/44 (40%), Positives = 23/44 (52%)
Frame = +1

Query: 121 SPYIEAVKRAKASQRSPTLNPNGYILMAQAENMLSFELVHKKMK 252
SPY + K P NPNG I M AEN L F+L+ + +K
Sbjct: 25 SPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCFDLIEEWIK 68


>sp|Q9MB95|1A11_PRUMU 1-aminocyclopropane-1-carboxylate synthase 1
OS=Prunus mume GN=ACS1 PE=2 SV=1
Length = 492

Score = 35.4 bits (80), Expect = 0.17
Identities = 18/44 (40%), Positives = 23/44 (52%)
Frame = +1

Query: 121 SPYIEAVKRAKASQRSPTLNPNGYILMAQAENMLSFELVHKKMK 252
SPY + K + PT NP G I M AEN LSF+ + +K
Sbjct: 26 SPYFDGWKAYDRNPFHPTKNPEGVIQMGLAENQLSFDSIEDWIK 69


>sp|P44495|MIAA_HAEIN tRNA delta(2)-isopentenylpyrophosphate
transferase OS=Haemophilus influenzae GN=miaA PE=3 SV=1
Length = 311

Score = 34.3 bits (77), Expect = 0.38
Identities = 25/81 (30%), Positives = 37/81 (45%)
Frame = -1

Query: 511 MENRCYKNLHCGFRSEVEKLACAMQLRLISDKMNLQ*QISCTGFHTMWHFTQLLDFIFIT 332
+E R +K + GF++EVEKL L + NL I C G+ MW + Q
Sbjct: 207 IEQRFHKMIELGFQAEVEKLYARGDLNI-----NLP-SIRCVGYRQMWEYLQ-------- 252

Query: 331 GENNHNQLGFSDAKARVQLVK 269
G+ + ++ F A QL K
Sbjct: 253 GDYAYEEMIFRGICATRQLAK 273


>sp|P18485|1A12_SOLLC 1-aminocyclopropane-1-carboxylate synthase 2
OS=Solanum lycopersicum GN=ACS2 PE=1 SV=2
Length = 485

Score = 33.9 bits (76), Expect = 0.50
Identities = 17/44 (38%), Positives = 22/44 (50%)
Frame = +1

Query: 121 SPYIEAVKRAKASQRSPTLNPNGYILMAQAENMLSFELVHKKMK 252
SPY + K + P NPNG I M AEN L +L+ +K
Sbjct: 25 SPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCLDLIEDWIK 68


>sp|Q6MKR6|SYE_BDEBA Glutamyl-tRNA synthetase OS=Bdellovibrio
bacteriovorus GN=gltX PE=3 SV=1
Length = 490

Score = 32.7 bits (73), Expect = 1.1
Identities = 17/47 (36%), Positives = 27/47 (57%)
Frame = +1

Query: 91 AWGSKALIPFSPYIEAVKRAKASQRSPTLNPNGYILMAQAENMLSFE 231
AW SK+L F PY+E + A A + LN Y+++ +A+ L +E
Sbjct: 362 AWQSKSLDLFKPYMEIL--ADAIELYRPLNDKSYVILPEADETLKWE 406


>sp|Q7U347|MIAA_BLOFL tRNA delta(2)-isopentenylpyrophosphate
transferase OS=Blochmannia floridanus GN=miaA PE=3 SV=1
Length = 323

Score = 32.7 bits (73), Expect = 1.1
Identities = 24/81 (29%), Positives = 34/81 (41%)
Frame = -1

Query: 511 MENRCYKNLHCGFRSEVEKLACAMQLRLISDKMNLQ*QISCTGFHTMWHFTQLLDFIFIT 332
+E R YK L GF EV L L Q ISC G+ MW +++
Sbjct: 218 IEQRFYKMLKSGFEDEVRLLFSRPDLH-----DGYQSSISCVGYRQMWE--------YLS 264

Query: 331 GENNHNQLGFSDAKARVQLVK 269
G ++Q+ + A +LVK
Sbjct: 265 GNVEYDQMIYKGIYATRRLVK 285


>sp|P31531|1A1C_SOYBN 1-aminocyclopropane-1-carboxylate synthase
OS=Glycine max GN=ACS1 PE=2 SV=1
Length = 484

Score = 32.7 bits (73), Expect = 1.1
Identities = 17/39 (43%), Positives = 21/39 (53%)
Frame = +1

Query: 121 SPYIEAVKRAKASQRSPTLNPNGYILMAQAENMLSFELV 237
SPY + K + P NPNG I M AEN L+ +LV
Sbjct: 25 SPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTSDLV 63


>sp|Q10DK7|1A11_ORYSJ 1-aminocyclopropane-1-carboxylate synthase 1
OS=Oryza sativa subsp. japonica GN=ACC1 PE=2 SV=1
Length = 487

Score = 32.7 bits (73), Expect = 1.1
Identities = 21/64 (32%), Positives = 30/64 (46%)
Frame = +1

Query: 52 LSQKPGRGAHGSLAWGSKALIPFSPYIEAVKRAKASQRSPTLNPNGYILMAQAENMLSFE 231
LS+K G +HG S Y + + + P NP+G I M AEN LSF+
Sbjct: 14 LSKKAGCNSHGQ----------DSSYFLGWQEYEKNPFDPVSNPSGIIQMGLAENQLSFD 63

Query: 232 LVHK 243
L+ +
Sbjct: 64 LLEE 67


tr_hit_id A2IA43
Definition tr|A2IA43|A2IA43_PSEMZ Truncated ACC synthase OS=Pseudotsuga menziesii
Align length 78
Score (bit) 44.3
E-value 0.004
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916944|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_H02.
(529 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A2IA43|A2IA43_PSEMZ Truncated ACC synthase OS=Pseudotsuga men... 44 0.004
tr|A2IA40|A2IA40_9CONI ACC synthase OS=Picea engelmannii x Picea... 44 0.004
tr|B2WR79|B2WR79_9ROSI 1-aminocyclopropane-1-carboxylate synthas... 44 0.007
tr|A2IA39|A2IA39_9CONI ACC synthase OS=Picea engelmannii x Picea... 44 0.007
tr|Q71T08|Q71T08_MOMCH 1-aminocyclopropane-1-carboxylate synthas... 43 0.011
tr|Q71T06|Q71T06_MOMCH 1-aminocyclopropane-1-carboxylate synthas... 40 0.056
tr|B7U9D2|B7U9D2_MOMCH 1-aminocyclopropane-1-carboxylate synthas... 40 0.056
tr|Q9MB76|Q9MB76_POPEU 1-aminocyclopropane-1-carboxylate synthas... 39 0.13
tr|Q9S7I1|Q9S7I1_CITSI ACC synthase OS=Citrus sinensis GN=acs1 P... 39 0.21
tr|Q9M3Y8|Q9M3Y8_CITSI ACC synthase (Fragment) OS=Citrus sinensi... 39 0.21
tr|Q9ZRC8|Q9ZRC8_CARPA ACC synthase OS=Carica papaya PE=2 SV=1 38 0.28
tr|Q9MB85|Q9MB85_CUCME 1-aminocyclopropane-1-carboxylate synthas... 38 0.28
tr|Q9FEM2|Q9FEM2_CUCME 1-aminocyclopropane-1-carboxylate synthas... 38 0.28
tr|Q9AVH0|Q9AVH0_PEA ACC synthase OS=Pisum sativum GN=Ps-ACS3 PE... 38 0.28
tr|O82124|O82124_CUCSA ACC synthase (1-aminocyclopropane-1-carbo... 38 0.28
tr|O49819|O49819_CARPA 1-aminocyclopropane-1-carboxylate synthas... 38 0.28
tr|A4N3C6|A4N3C6_HAEIN tRNA delta(2)-isopentenylpyrophosphate tr... 38 0.37
tr|Q52PB1|Q52PB1_PRUPE 1-aminocyclopropane-1-carboxylate synthas... 38 0.37
tr|A2IBN7|A2IBN7_GOSHI ACC synthase OS=Gossypium hirsutum GN=ACS... 38 0.37
tr|A4NKK8|A4NKK8_HAEIN tRNA delta(2)-isopentenylpyrophosphate tr... 37 0.48
tr|Q9MB64|Q9MB64_MALDO 1-aminocyclopropane-1-carboxylate synthas... 37 0.48
tr|Q8L826|Q8L826_BETVE 1-aminocyclopropane-1-carboxylate synthas... 37 0.48
tr|Q3BK18|Q3BK18_CARPA 1-aminocyclopropane-1-carboxylate synthas... 37 0.48
tr|B2XCK2|B2XCK2_9ROSA 1-aminocyclopropane 1-carboxylate synthas... 37 0.48
tr|Q9SEJ9|Q9SEJ9_LUPAL 1-aminocyclopropane-1-carboxylate synthas... 37 0.62
tr|Q94II6|Q94II6_CUCMA ACC synthase OS=Cucurbita maxima GN=CM-AC... 37 0.62
tr|Q9MB65|Q9MB65_MALDO 1-aminocyclopropane-1-carboxylate synthas... 37 0.81
tr|Q08LX2|Q08LX2_OROMI ACC synthase OS=Orobanche minor GN=OM-ACS... 37 0.81
tr|A1IIU0|A1IIU0_9ROSA 1-aminocyclopropane-1-carboxylate synthas... 37 0.81
tr|A4P0M9|A4P0M9_HAEIN tRNA delta(2)-isopentenylpyrophosphate tr... 36 1.1

>tr|A2IA43|A2IA43_PSEMZ Truncated ACC synthase OS=Pseudotsuga
menziesii GN=ACS3 PE=2 SV=1
Length = 399

Score = 44.3 bits (103), Expect = 0.004
Identities = 28/78 (35%), Positives = 39/78 (50%)
Frame = +1

Query: 4 LCAPDASHEEWK*MESLSQKPGRGAHGSLAWGSKALIPFSPYIEAVKRAKASQRSPTLNP 183
+C P ++ ++ + P RG S SKA SPY + K A+ PT NP
Sbjct: 1 MCKPTTQRQQ----QANPRMPARGVCLSSLATSKAHGEVSPYFDGWKEYDANPYHPTDNP 56

Query: 184 NGYILMAQAENMLSFELV 237
+G I M AEN LSF+L+
Sbjct: 57 SGIIQMGLAENQLSFDLL 74


>tr|A2IA40|A2IA40_9CONI ACC synthase OS=Picea engelmannii x Picea
glauca GN=ACS3b PE=2 SV=1
Length = 520

Score = 44.3 bits (103), Expect = 0.004
Identities = 28/78 (35%), Positives = 39/78 (50%)
Frame = +1

Query: 4 LCAPDASHEEWK*MESLSQKPGRGAHGSLAWGSKALIPFSPYIEAVKRAKASQRSPTLNP 183
+C P ++ ++ + P RG S SKA SPY + K A+ PT NP
Sbjct: 1 MCKPTTQRQQ----QANPRMPARGVCLSSLATSKAHGEVSPYFDGWKEYDANPYHPTDNP 56

Query: 184 NGYILMAQAENMLSFELV 237
+G I M AEN LSF+L+
Sbjct: 57 SGIIQMGLAENQLSFDLL 74


>tr|B2WR79|B2WR79_9ROSI 1-aminocyclopropane-1-carboxylate synthase
OS=Citrullus colocynthis x Citrullus lanatus var.
lanatus GN=ACS1 PE=4 SV=1
Length = 486

Score = 43.5 bits (101), Expect = 0.007
Identities = 22/44 (50%), Positives = 25/44 (56%)
Frame = +1

Query: 121 SPYIEAVKRAKASQRSPTLNPNGYILMAQAENMLSFELVHKKMK 252
SPY + K + PT+NP G I M AEN LSFE V K MK
Sbjct: 26 SPYFDGWKAYDSDPFHPTMNPRGVIQMGLAENQLSFEFVEKWMK 69


>tr|A2IA39|A2IA39_9CONI ACC synthase OS=Picea engelmannii x Picea
glauca GN=ACS3a PE=2 SV=1
Length = 520

Score = 43.5 bits (101), Expect = 0.007
Identities = 28/78 (35%), Positives = 39/78 (50%)
Frame = +1

Query: 4 LCAPDASHEEWK*MESLSQKPGRGAHGSLAWGSKALIPFSPYIEAVKRAKASQRSPTLNP 183
+C P ++ ++ + P RG S SKA SPY + K A+ PT NP
Sbjct: 1 MCKPTTQRQQ----QANPRMPARGVCLSSLATSKAHGEDSPYFDGWKEYDANPYHPTDNP 56

Query: 184 NGYILMAQAENMLSFELV 237
+G I M AEN LSF+L+
Sbjct: 57 SGVIQMGLAENQLSFDLL 74


>tr|Q71T08|Q71T08_MOMCH 1-aminocyclopropane-1-carboxylate synthase
OS=Momordica charantia GN=ACS1 PE=2 SV=1
Length = 484

Score = 42.7 bits (99), Expect = 0.011
Identities = 22/44 (50%), Positives = 25/44 (56%)
Frame = +1

Query: 121 SPYIEAVKRAKASQRSPTLNPNGYILMAQAENMLSFELVHKKMK 252
SPY + K + PTLNP G I M QAEN LSF V K M+
Sbjct: 26 SPYFDGWKAYDSDPFHPTLNPRGVIEMGQAENQLSFGFVEKWMR 69


>tr|Q71T06|Q71T06_MOMCH 1-aminocyclopropane-1-carboxylate synthase
OS=Momordica charantia GN=ACS3 PE=2 SV=1
Length = 484

Score = 40.4 bits (93), Expect = 0.056
Identities = 21/44 (47%), Positives = 24/44 (54%)
Frame = +1

Query: 121 SPYIEAVKRAKASQRSPTLNPNGYILMAQAENMLSFELVHKKMK 252
SPY + K + PTLNP G I M AEN LSF V K M+
Sbjct: 26 SPYFDGWKAYDSDPFHPTLNPRGVIQMGLAENQLSFGFVEKWMR 69


>tr|B7U9D2|B7U9D2_MOMCH 1-aminocyclopropane-1-carboxylate synthase
OS=Momordica charantia GN=ACS4 PE=2 SV=1
Length = 484

Score = 40.4 bits (93), Expect = 0.056
Identities = 21/44 (47%), Positives = 24/44 (54%)
Frame = +1

Query: 121 SPYIEAVKRAKASQRSPTLNPNGYILMAQAENMLSFELVHKKMK 252
SPY + K + PTLNP G I M AEN LSF V K M+
Sbjct: 26 SPYFDGWKAYDSDPFHPTLNPRGVIQMGLAENQLSFGFVEKWMR 69


>tr|Q9MB76|Q9MB76_POPEU 1-aminocyclopropane-1-carboxylate synthase
OS=Populus euphratica GN=peacs-1 PE=2 SV=1
Length = 481

Score = 39.3 bits (90), Expect = 0.13
Identities = 19/44 (43%), Positives = 24/44 (54%)
Frame = +1

Query: 121 SPYIEAVKRAKASQRSPTLNPNGYILMAQAENMLSFELVHKKMK 252
SPY + K + PT NPNG I M AEN L F+L+ +K
Sbjct: 23 SPYFDGWKAYDSDPHHPTDNPNGVIQMGLAENQLCFDLIQDWLK 66


>tr|Q9S7I1|Q9S7I1_CITSI ACC synthase OS=Citrus sinensis GN=acs1 PE=2
SV=1
Length = 483

Score = 38.5 bits (88), Expect = 0.21
Identities = 19/39 (48%), Positives = 23/39 (58%)
Frame = +1

Query: 121 SPYIEAVKRAKASQRSPTLNPNGYILMAQAENMLSFELV 237
SPY + K ++ PT NPNG I M AEN+L ELV
Sbjct: 25 SPYFDGWKAFESDPYHPTKNPNGVIQMGLAENLLCHELV 63


>tr|Q9M3Y8|Q9M3Y8_CITSI ACC synthase (Fragment) OS=Citrus sinensis
GN=acs2 PE=2 SV=1
Length = 403

Score = 38.5 bits (88), Expect = 0.21
Identities = 19/39 (48%), Positives = 23/39 (58%)
Frame = +1

Query: 121 SPYIEAVKRAKASQRSPTLNPNGYILMAQAENMLSFELV 237
SPY + K ++ PT NPNG I M AEN+L ELV
Sbjct: 25 SPYFDGWKAFESDPYHPTKNPNGVIQMGLAENLLCHELV 63