BP916951
Clone id YMU001_000093_H09
Library
Length 510
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000093_H09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGATGCACTTAGCAAGGCCAAGTCATTTGATGAGAGACTGCAGCTCTCTGCTAATGCAAC
TTCCAGAGTGGCTTCATTCAATAAGAGGATCGGCTTGGCAGACAAGTTGACTGCAGGAGC
ATCAGCAGTGAACATGACTATGCGGTCTGTCAATGACAAGTACCAAATTACAGGGAAGAC
TGTGTCGGTGTATGTGTATGCTCATCAAGGGGTGAAGACTGCGGGGATTGCCATTGCAAA
TACTAAGCTTGTACAATCTGGGAGCGTGTGGGTTAGCTCGGCACTTTACAGGGTGGCAAA
GGCTGCAGGCGATGTGACCTGCAACATCAAGGGTAGATTGGGCTCATCTGAAGCTCCGAA
GCTGAGAGCAGCCGCTTGAAATTGTAGTTCTGCCTGTGGAGGTTTGCAGTTGCAAAAGCG
TGTGCTAATCAAAATTGTTAAAATGTACAGTGGTTGCAAGTGCCAAGGTACGGACCGGTT
AACGAGTATATCAATCTCACATAAAGATAC
■■Homology search results ■■ -
sp_hit_id A5CC96
Definition sp|A5CC96|RL1_ORITB 50S ribosomal protein L1 OS=Orientia tsutsugamushi (strain Boryong)
Align length 131
Score (bit) 32.7
E-value 1.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916951|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_H09.
(510 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A5CC96|RL1_ORITB 50S ribosomal protein L1 OS=Orientia tsutsug... 33 1.0
sp|Q12986|NFX1_HUMAN Transcriptional repressor NF-X1 OS=Homo sap... 30 5.0
sp|P73833|CPHA_SYNY3 Cyanophycin synthetase OS=Synechocystis sp.... 30 5.0
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3... 30 5.0
sp|P02468|LAMC1_MOUSE Laminin subunit gamma-1 OS=Mus musculus GN... 30 6.5
sp|A6QLA0|NFX1_BOVIN Transcriptional repressor NF-X1 OS=Bos taur... 30 6.6

>sp|A5CC96|RL1_ORITB 50S ribosomal protein L1 OS=Orientia
tsutsugamushi (strain Boryong) GN=rplA PE=3 SV=1
Length = 248

Score = 32.7 bits (73), Expect = 1.0
Identities = 36/131 (27%), Positives = 54/131 (41%), Gaps = 12/131 (9%)
Frame = +2

Query: 8 LSKAKSFDERLQLSANATSRVASFNKRIGLADKLTAGASAVNMTMRSVNDKYQITGKTVS 187
+ K K +D R S A FN+ + +A KL S + +R V TGKTV
Sbjct: 26 IDKQKCYDVREACSIIKEISFAKFNETVDIAIKLGVNPSHSSQVVRGVAAMPSGTGKTVK 85

Query: 188 VYVYAHQ----GVKTAGIAIANT----KLVQSGS----VWVSSALYRVAKAAGDVTCNIK 331
V V + KT G I + + ++SG+ V++++ VA + I
Sbjct: 86 VAVICQEEKLDEFKTTGADIVGSLDIIEAIKSGNIDYDVYITTPAMMVAVSQ---VARIL 142

Query: 332 GRLGSSEAPKL 364
G G PKL
Sbjct: 143 GPKGLMPNPKL 153


>sp|Q12986|NFX1_HUMAN Transcriptional repressor NF-X1 OS=Homo
sapiens GN=NFX1 PE=1 SV=2
Length = 1120

Score = 30.4 bits (67), Expect = 5.0
Identities = 14/54 (25%), Positives = 19/54 (35%)
Frame = -3

Query: 379 SSGCSQLRSFR*AQSTLDVAGHIACSLCHPVKCRANPHAPRLYKLSICNGNPRS 218
S G + L H +CHP C+ P P+L + C P S
Sbjct: 549 SDGFGDFSCLKICGKDLKCGNHTCSQVCHPQPCQQCPRLPQLVRCCPCGQTPLS 602


>sp|P73833|CPHA_SYNY3 Cyanophycin synthetase OS=Synechocystis sp.
(strain PCC 6803) GN=cphA PE=3 SV=1
Length = 873

Score = 30.4 bits (67), Expect = 5.0
Identities = 19/69 (27%), Positives = 33/69 (47%)
Frame = +2

Query: 104 KLTAGASAVNMTMRSVNDKYQITGKTVSVYVYAHQGVKTAGIAIANTKLVQSGSVWVSSA 283
K+ +A+++ R + + K VY+ A + T GIAI T + ++W+
Sbjct: 359 KIVVNKTAIDVMERQGYNLDSVLPKDEVVYLRATANLSTGGIAIDRTDDIHPENIWL--- 415

Query: 284 LYRVAKAAG 310
+ RVAK G
Sbjct: 416 MERVAKVIG 424


>sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3
homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2
Length = 1787

Score = 30.4 bits (67), Expect = 5.0
Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
Frame = -3

Query: 301 LCHPVKCRANPHAPRL-YKLSICNGNPRSLHPL 206
L VK P APRL YK +IC+G LH L
Sbjct: 1466 LASEVKVEEEPKAPRLPYKFNICDGGYTELHSL 1498


>sp|P02468|LAMC1_MOUSE Laminin subunit gamma-1 OS=Mus musculus
GN=Lamc1 PE=1 SV=2
Length = 1607

Score = 30.0 bits (66), Expect = 6.5
Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%)
Frame = +1

Query: 187 GVCVCSSR--GEDCGDCHCKY*ACTIWERVG*LGTLQGGKGCRRCDLQHQG 333
G C C G DCG C Y LQ G+GC RCD G
Sbjct: 901 GQCQCLPHVSGRDCGTCDPGY------------YNLQSGQGCERCDCHALG 939


>sp|A6QLA0|NFX1_BOVIN Transcriptional repressor NF-X1 OS=Bos taurus
GN=NFX1 PE=2 SV=1
Length = 1116

Score = 30.0 bits (66), Expect = 6.6
Identities = 12/38 (31%), Positives = 16/38 (42%)
Frame = -3

Query: 331 LDVAGHIACSLCHPVKCRANPHAPRLYKLSICNGNPRS 218
L H +CHP C+ P P+L + C P S
Sbjct: 562 LKCGNHTCSQVCHPQPCQPCPRLPQLVRYCPCGQTPLS 599


tr_hit_id A7PC44
Definition tr|A7PC44|A7PC44_VITVI Chromosome chr2 scaffold_11, whole genome shotgun sequence OS=Vitis vinifera
Align length 122
Score (bit) 108.0
E-value 1.0e-22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916951|Adiantum capillus-veneris mRNA, clone:
YMU001_000093_H09.
(510 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PC44|A7PC44_VITVI Chromosome chr2 scaffold_11, whole genome... 108 1e-22
tr|A5BZQ5|A5BZQ5_VITVI Putative uncharacterized protein OS=Vitis... 108 2e-22
tr|A9PE83|A9PE83_POPTR Putative uncharacterized protein OS=Popul... 106 6e-22
tr|Q7X5Z1|Q7X5Z1_ORYSA OSJNBa0006A01.14 protein (OSIGBa0142I02-O... 104 2e-21
tr|Q0JAJ6|Q0JAJ6_ORYSJ Os04g0594400 protein OS=Oryza sativa subs... 104 2e-21
tr|A2XX23|A2XX23_ORYSI Putative uncharacterized protein OS=Oryza... 104 2e-21
tr|B7FIB3|B7FIB3_MEDTR Putative uncharacterized protein OS=Medic... 100 3e-20
tr|Q7FS90|Q7FS90_MAIZE Putative aldose reductase-related protein... 100 4e-20
tr|B8LNT1|B8LNT1_PICSI Putative uncharacterized protein OS=Picea... 100 5e-20
tr|Q8LA96|Q8LA96_ARATH Putative splicing regulatory protein (Put... 99 1e-19
tr|O23612|O23612_ARATH Putative uncharacterized protein dl4895c ... 99 1e-19
tr|A9S560|A9S560_PHYPA Predicted protein (Fragment) OS=Physcomit... 99 1e-19
tr|Q9LUK4|Q9LUK4_ARATH Arabidopsis thaliana genomic DNA, chromos... 99 2e-19
tr|Q6NM69|Q6NM69_ARATH At5g46870 OS=Arabidopsis thaliana GN=At5g... 99 2e-19
tr|B6TB94|B6TB94_MAIZE Nucleic acid binding protein OS=Zea mays ... 99 2e-19
tr|A7P3Y1|A7P3Y1_VITVI Chromosome chr1 scaffold_5, whole genome ... 98 3e-19
tr|Q9LFD5|Q9LFD5_ARATH Putative uncharacterized protein F5E19_18... 96 1e-18
tr|Q93Z43|Q93Z43_ARATH AT5g16840/F5E19_180 OS=Arabidopsis thalia... 96 1e-18
tr|Q8LB67|Q8LB67_ARATH Putative uncharacterized protein OS=Arabi... 96 1e-18
tr|Q25BM1|Q25BM1_BRAOL RNA recognition motif. (A.k.a. RRM, RBD, ... 96 1e-18
tr|A8MSB5|A8MSB5_ARATH Uncharacterized protein At5g16840.2 OS=Ar... 96 1e-18
tr|A8MQX8|A8MQX8_ARATH Uncharacterized protein At5g16840.3 OS=Ar... 96 1e-18
tr|Q5VRZ6|Q5VRZ6_ORYSJ cDNA clone:001-011-A08, full insert seque... 95 2e-18
tr|Q2A977|Q2A977_BRAOL RNA recognition motif (RRM)-containing pr... 95 2e-18
tr|Q0DF65|Q0DF65_ORYSJ Os06g0112400 protein (Fragment) OS=Oryza ... 95 2e-18
tr|A5BGE0|A5BGE0_VITVI Putative uncharacterized protein OS=Vitis... 95 2e-18
tr|A3B7P7|A3B7P7_ORYSJ Putative uncharacterized protein OS=Oryza... 95 2e-18
tr|A2Y8H4|A2Y8H4_ORYSI Putative uncharacterized protein OS=Oryza... 95 2e-18
tr|B4FEG8|B4FEG8_MAIZE Nucleic acid binding protein OS=Zea mays ... 94 3e-18
tr|A7PBA3|A7PBA3_VITVI Chromosome chr16 scaffold_10, whole genom... 94 5e-18

>tr|A7PC44|A7PC44_VITVI Chromosome chr2 scaffold_11, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015704001
PE=4 SV=1
Length = 308

Score = 108 bits (270), Expect = 1e-22
Identities = 56/122 (45%), Positives = 83/122 (68%)
Frame = +2

Query: 2 DALSKAKSFDERLQLSANATSRVASFNKRIGLADKLTAGASAVNMTMRSVNDKYQITGKT 181
DA++KAKSFDE+ QL++ ATS+V SF+K+IG +K++AG S VN +R V+ K+Q++ KT
Sbjct: 151 DAVNKAKSFDEKHQLTSTATSKVVSFDKKIGFTEKISAGTSVVNEKVREVDHKFQVSDKT 210

Query: 182 VSVYVYAHQGVKTAGIAIANTKLVQSGSVWVSSALYRVAKAAGDVTCNIKGRLGSSEAPK 361
S + A Q V +AG AI + V +G+ WV+ A +VAKAA +V K ++G SE +
Sbjct: 211 KSAFAAAEQKVSSAGSAIMKNRYVFTGASWVTGAFNKVAKAAEEVGQKAKEKVGKSEDEQ 270

Query: 362 LR 367
R
Sbjct: 271 KR 272


>tr|A5BZQ5|A5BZQ5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_028374 PE=4 SV=1
Length = 782

Score = 108 bits (269), Expect = 2e-22
Identities = 56/122 (45%), Positives = 83/122 (68%)
Frame = +2

Query: 2 DALSKAKSFDERLQLSANATSRVASFNKRIGLADKLTAGASAVNMTMRSVNDKYQITGKT 181
DA++KAKSFDE+ QL++ ATS+V SF+K+IG +K++AG S VN +R V+ K+Q++ KT
Sbjct: 625 DAVNKAKSFDEKHQLTSTATSKVVSFDKKIGFTEKISAGTSVVNEKVREVDHKFQVSEKT 684

Query: 182 VSVYVYAHQGVKTAGIAIANTKLVQSGSVWVSSALYRVAKAAGDVTCNIKGRLGSSEAPK 361
S + A Q V +AG AI + V +G+ WV+ A +VAKAA +V K ++G SE +
Sbjct: 685 KSAFAAAEQKVSSAGSAIMKNRYVFTGASWVTGAFNKVAKAAEEVGQKAKEKVGKSEDEQ 744

Query: 362 LR 367
R
Sbjct: 745 KR 746


>tr|A9PE83|A9PE83_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 280

Score = 106 bits (265), Expect = 6e-22
Identities = 53/122 (43%), Positives = 83/122 (68%)
Frame = +2

Query: 2 DALSKAKSFDERLQLSANATSRVASFNKRIGLADKLTAGASAVNMTMRSVNDKYQITGKT 181
DA++KAK FDE+ QL++ A+++V SF+K+IGL +K++AG + V +R V+ K+Q++ KT
Sbjct: 123 DAINKAKGFDEKHQLTSTASAKVVSFDKKIGLTEKISAGTTVVGDKVREVDQKFQVSEKT 182

Query: 182 VSVYVYAHQGVKTAGIAIANTKLVQSGSVWVSSALYRVAKAAGDVTCNIKGRLGSSEAPK 361
S + A Q V +AG AI + + V +G+ WV+ A +VAKAAGDV K + G +E +
Sbjct: 183 KSAFAVAEQKVSSAGSAIMSNRYVFTGAAWVTGAFNKVAKAAGDVGQKAKEKAGMAEEEQ 242

Query: 362 LR 367
R
Sbjct: 243 KR 244


>tr|Q7X5Z1|Q7X5Z1_ORYSA OSJNBa0006A01.14 protein
(OSIGBa0142I02-OSIGBa0101B20.28 protein)
(OSJNBa0009P12.34 protein) OS=Oryza sativa
GN=OSJNBa0006A01.14 PE=4 SV=3
Length = 314

Score = 104 bits (260), Expect = 2e-21
Identities = 52/120 (43%), Positives = 80/120 (66%)
Frame = +2

Query: 2 DALSKAKSFDERLQLSANATSRVASFNKRIGLADKLTAGASAVNMTMRSVNDKYQITGKT 181
DAL +AK+ DE+ QL++ AT+RV+SF+K++GL++K++ G SAVN ++ ++ KYQ++ KT
Sbjct: 122 DALDRAKALDEKHQLTSTATARVSSFDKKMGLSEKISVGTSAVNDKVKEMDQKYQVSEKT 181

Query: 182 VSVYVYAHQGVKTAGIAIANTKLVQSGSVWVSSALYRVAKAAGDVTCNIKGRLGSSEAPK 361
S A Q V TAG AI + V +G+ WV+ A +VA AA DV K ++ S + K
Sbjct: 182 RSALAAAEQSVSTAGSAIMKNRYVLTGAAWVTGAFNKVANAANDVGTKAKEKIASEQEHK 241


>tr|Q0JAJ6|Q0JAJ6_ORYSJ Os04g0594400 protein OS=Oryza sativa subsp.
japonica GN=Os04g0594400 PE=2 SV=1
Length = 314

Score = 104 bits (260), Expect = 2e-21
Identities = 52/120 (43%), Positives = 80/120 (66%)
Frame = +2

Query: 2 DALSKAKSFDERLQLSANATSRVASFNKRIGLADKLTAGASAVNMTMRSVNDKYQITGKT 181
DAL +AK+ DE+ QL++ AT+RV+SF+K++GL++K++ G SAVN ++ ++ KYQ++ KT
Sbjct: 122 DALDRAKALDEKHQLTSTATARVSSFDKKMGLSEKISVGTSAVNDKVKEMDQKYQVSEKT 181

Query: 182 VSVYVYAHQGVKTAGIAIANTKLVQSGSVWVSSALYRVAKAAGDVTCNIKGRLGSSEAPK 361
S A Q V TAG AI + V +G+ WV+ A +VA AA DV K ++ S + K
Sbjct: 182 RSALAAAEQSVSTAGSAIMKNRYVLTGAAWVTGAFNKVANAANDVGTKAKEKIASEQEHK 241


>tr|A2XX23|A2XX23_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_17216 PE=4 SV=1
Length = 314

Score = 104 bits (260), Expect = 2e-21
Identities = 52/120 (43%), Positives = 80/120 (66%)
Frame = +2

Query: 2 DALSKAKSFDERLQLSANATSRVASFNKRIGLADKLTAGASAVNMTMRSVNDKYQITGKT 181
DAL +AK+ DE+ QL++ AT+RV+SF+K++GL++K++ G SAVN ++ ++ KYQ++ KT
Sbjct: 122 DALDRAKALDEKHQLTSTATARVSSFDKKMGLSEKISVGTSAVNDKVKEMDQKYQVSEKT 181

Query: 182 VSVYVYAHQGVKTAGIAIANTKLVQSGSVWVSSALYRVAKAAGDVTCNIKGRLGSSEAPK 361
S A Q V TAG AI + V +G+ WV+ A +VA AA DV K ++ S + K
Sbjct: 182 RSALAAAEQSVSTAGSAIMKNRYVLTGAAWVTGAFNKVANAANDVGTKAKEKIASEQEHK 241


>tr|B7FIB3|B7FIB3_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 282

Score = 100 bits (250), Expect = 3e-20
Identities = 53/122 (43%), Positives = 84/122 (68%)
Frame = +2

Query: 2 DALSKAKSFDERLQLSANATSRVASFNKRIGLADKLTAGASAVNMTMRSVNDKYQITGKT 181
DA++KAK+FDE+LQLS+ A++ VAS ++++GL+DK+ AGAS V+ +R V+ K+ ++ KT
Sbjct: 123 DAVNKAKTFDEKLQLSSKASATVASVDQKLGLSDKIGAGASVVSDKVRGVDQKFLVSEKT 182

Query: 182 VSVYVYAHQGVKTAGIAIANTKLVQSGSVWVSSALYRVAKAAGDVTCNIKGRLGSSEAPK 361
S + A Q V TAG AI + V +G+ WV+ A RV+KAA +V K ++ ++E +
Sbjct: 183 KSAFAAAEQTVSTAGSAIMKNRYVLTGASWVTGAFNRVSKAAVEVGQKTKEKVENAEQQE 242

Query: 362 LR 367
R
Sbjct: 243 KR 244


>tr|Q7FS90|Q7FS90_MAIZE Putative aldose reductase-related protein
OS=Zea mays GN=Z138B04_Z333J11.16 PE=4 SV=1
Length = 589

Score = 100 bits (249), Expect = 4e-20
Identities = 51/120 (42%), Positives = 75/120 (62%)
Frame = +2

Query: 2 DALSKAKSFDERLQLSANATSRVASFNKRIGLADKLTAGASAVNMTMRSVNDKYQITGKT 181
DAL KAK+ DE+ QL++ AT+RV+SF+KRIGL++K++ G S VN ++ ++ KYQ++ KT
Sbjct: 400 DALDKAKALDEKHQLTSTATARVSSFDKRIGLSEKISVGTSVVNDKVKEMDQKYQVSEKT 459

Query: 182 VSVYVYAHQGVKTAGIAIANTKLVQSGSVWVSSALYRVAKAAGDVTCNIKGRLGSSEAPK 361
S A Q V T G AI V +G+ WV+ A +V AA DV K ++ + K
Sbjct: 460 KSALAAAEQSVLTVGSAIMKNMYVLTGAAWVTGAFSKVTSAANDVGAKAKEKIAVEQEDK 519


>tr|B8LNT1|B8LNT1_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 245

Score = 100 bits (248), Expect = 5e-20
Identities = 52/105 (49%), Positives = 75/105 (71%)
Frame = +2

Query: 2 DALSKAKSFDERLQLSANATSRVASFNKRIGLADKLTAGASAVNMTMRSVNDKYQITGKT 181
DALSKAKSFDE Q++A+A ++VAS KRIG+ DK++AGA AV R+V +KY ++ KT
Sbjct: 139 DALSKAKSFDETHQVTASAAAKVASLGKRIGINDKISAGAEAV----RAVENKYHVSEKT 194

Query: 182 VSVYVYAHQGVKTAGIAIANTKLVQSGSVWVSSALYRVAKAAGDV 316
S+ + A Q V TAG A+ N++ +G++WVS L + A+AA D+
Sbjct: 195 KSMLLVAEQTVSTAGTAVVNSRYFTAGALWVSGVLEKAAQAAADL 239


>tr|Q8LA96|Q8LA96_ARATH Putative splicing regulatory protein
(Putative RRM-containing protein) OS=Arabidopsis
thaliana GN=At4g17720 PE=2 SV=1
Length = 313

Score = 99.0 bits (245), Expect = 1e-19
Identities = 51/117 (43%), Positives = 75/117 (64%)
Frame = +2

Query: 2 DALSKAKSFDERLQLSANATSRVASFNKRIGLADKLTAGASAVNMTMRSVNDKYQITGKT 181
DA++KAKS DE+ QL++ A+++VASF+K+IG DK+ G V +R V+ KYQ++ KT
Sbjct: 125 DAIAKAKSVDEKHQLTSTASAKVASFDKKIGFTDKINTGTVVVGEKVREVDQKYQVSEKT 184

Query: 182 VSVYVYAHQGVKTAGIAIANTKLVQSGSVWVSSALYRVAKAAGDVTCNIKGRLGSSE 352
S A Q V AG AI + V +G+ WV+ A +VAKAA +V K ++G +E
Sbjct: 185 KSAIAAAEQTVSNAGSAIMKNRYVLTGATWVTGAFNKVAKAAEEVGQKAKEKVGMAE 241