BP916959
Clone id YMU001_000094_A07
Library
Length 277
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000094_A07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCCGACTGATAAAGAAGCTCAAATCTTCCATATGTTCATTGTACCAGACAGCCCATAATA
CACTTGCCATAAACATGCAGGTTAATTGCAGTTTGACCTCAAAATATACCTTGTCTATAT
TTGACAAACTATCAGGTCCATACAGCAACGAGCGTATTGCACTTACTGTTCTTGCAAACC
CTGTTACAAGCACCGAAAAGCACACTGCAAACGAAATGTAGCCCAGAGCTCTCCTTAAGA
CAATGCCAGCCAGGCTGGTGCTGGAAAATATCCATTG
■■Homology search results ■■ -
sp_hit_id A9BF33
Definition sp|A9BF33|RPOB_PETMO DNA-directed RNA polymerase subunit beta OS=Petrotoga mobilis (strain DSM 10674 / SJ95)
Align length 37
Score (bit) 29.3
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916959|Adiantum capillus-veneris mRNA, clone:
YMU001_000094_A07.
(277 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A9BF33|RPOB_PETMO DNA-directed RNA polymerase subunit beta OS... 29 6.4
sp|Q1DY99|XPOT_COCIM Exportin-T OS=Coccidioides immitis GN=LOS1 ... 29 8.3

>sp|A9BF33|RPOB_PETMO DNA-directed RNA polymerase subunit beta
OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpoB
PE=3 SV=1
Length = 1187

Score = 29.3 bits (64), Expect = 6.4
Identities = 12/37 (32%), Positives = 22/37 (59%)
Frame = +3

Query: 63 LAINMQVNCSLTSKYTLSIFDKLSGPYSNERIALTVL 173
+ +N V + +K TL + DKL+G + N+ + T+L
Sbjct: 922 IGVNKYVKVFIATKKTLQVGDKLAGRHGNKGVISTIL 958


>sp|Q1DY99|XPOT_COCIM Exportin-T OS=Coccidioides immitis GN=LOS1
PE=3 SV=1
Length = 1033

Score = 28.9 bits (63), Expect = 8.3
Identities = 12/42 (28%), Positives = 22/42 (52%)
Frame = -1

Query: 145 LYGPDSLSNIDKVYFEVKLQLTCMFMASVLWAVWYNEHMEDL 20
+YGPD + D + K+ T ++ S L+A +N +D+
Sbjct: 92 MYGPDGAAQSDPSNIQNKIAQTITYLFSALYATEWNTFFDDI 133


tr_hit_id A9SSI8
Definition tr|A9SSI8|A9SSI8_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 86
Score (bit) 56.2
E-value 8.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916959|Adiantum capillus-veneris mRNA, clone:
YMU001_000094_A07.
(277 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SSI8|A9SSI8_PHYPA Predicted protein OS=Physcomitrella paten... 56 8e-07
tr|A4HMM0|A4HMM0_LEIBR Putative uncharacterized protein OS=Leish... 37 0.50
tr|Q76MR1|Q76MR1_TAEGU Metabotropic GluR2 (Fragment) OS=Taeniopy... 33 9.4

>tr|A9SSI8|A9SSI8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_234032 PE=4 SV=1
Length = 379

Score = 56.2 bits (134), Expect = 8e-07
Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 4/86 (4%)
Frame = -1

Query: 271 IFSSTSLAGIVLRRALGYISFAVCFSVLVTGFARTVSAIRSLLYGPDSLSNIDKVYFEVK 92
+F S+S G++ R + C+SV+VT F + S IR ++ D LS +D +YFE
Sbjct: 223 MFLSSSKTGMMFWRTALSVGLGFCYSVIVTAFTKLASFIRFRVFVADELSEVDILYFEAH 282

Query: 91 LQLTCMFMASVLWAVW----YNEHME 26
LQ +F+AS+ W Y +H++
Sbjct: 283 LQALFLFVASMFSFFWLDADYEQHLD 308


>tr|A4HMM0|A4HMM0_LEIBR Putative uncharacterized protein
OS=Leishmania braziliensis GN=LbrM34_V2.1910 PE=4 SV=1
Length = 925

Score = 37.0 bits (84), Expect = 0.50
Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
Frame = -3

Query: 272 DIFQHQPGWH--CLKESSGLHFVCSVLFGACNRVCKNSKCNTLVAVW 138
D+ + + WH CL S +H +L G C + K +C+T AVW
Sbjct: 349 DLREKRVSWHLHCLIASKEVHSAARLLLGTCRDISKGLRCDTAEAVW 395


>tr|Q76MR1|Q76MR1_TAEGU Metabotropic GluR2 (Fragment) OS=Taeniopygia
guttata PE=2 SV=1
Length = 594

Score = 32.7 bits (73), Expect = 9.4
Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 4/78 (5%)
Frame = -1

Query: 274 WIFSSTSLAGIVLRRALGY-ISFAVCFSVLVT---GFARTVSAIRSLLYGPDSLSNIDKV 107
+IF + G+ R LG SFAVC+S L+T AR S ++ + P +S +V
Sbjct: 451 FIFIAKPSTGVCTLRRLGLGTSFAVCYSALLTKTNRIARIFSGVKEGVQRPRFISPTSQV 510

Query: 106 YFEVKLQLTCMFMASVLW 53
+ L ++C + ++W
Sbjct: 511 VICMAL-ISCQLIIVIIW 527