BP916961
Clone id YMU001_000094_A09
Library
Length 272
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000094_A09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCATCAACCCAAGGAAAAGCGTGAGGTACTCGGCCTCATTGTTACTTTCAGCTTCATCAA
GATTGTAAGCTCTAGAAAAGATTACATCGCCTTTTGGGTTCTTAATGACTACCCCACCAC
TTGCCTTTTGAAGAACTTTCCTGTATGCACCATCAAACATCATTGTATACGCATCTGTAA
TATCTACTTCCTCTTCATGATCATCCTTGTCAACCCTTGGGTAAGATGGAAGCTGCCCCC
CCTTATGTACCACTATGTCTGCCAAGTTAGCT
■■Homology search results ■■ -
sp_hit_id Q5ZL43
Definition sp|Q5ZL43|MTND_CHICK 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase OS=Gallus gallus
Align length 87
Score (bit) 35.8
E-value 0.069
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916961|Adiantum capillus-veneris mRNA, clone:
YMU001_000094_A09.
(272 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5ZL43|MTND_CHICK 1,2-dihydroxy-3-keto-5-methylthiopentene di... 36 0.069
sp|Q9BV57|MTND_HUMAN 1,2-dihydroxy-3-keto-5-methylthiopentene di... 31 2.2
sp|P21919|SOML_GADMO Somatolactin OS=Gadus morhua PE=1 SV=2 30 2.9
sp|Q975J9|RL18_SULTO 50S ribosomal protein L18P OS=Sulfolobus to... 29 6.4
sp|Q5F3F2|MYSM1_CHICK Protein MYSM1 OS=Gallus gallus GN=MYSM1 PE... 29 6.4
sp|Q6PBX5|MTND_DANRE 1,2-dihydroxy-3-keto-5-methylthiopentene di... 29 6.4
sp|P97855|G3BP1_MOUSE Ras GTPase-activating protein-binding prot... 29 6.4
sp|Q9YTU2|POLB_CHPVU ORFB polyprotein OS=Cryphonectria hypovirus... 29 8.4
sp|Q3ZBL1|MTND_BOVIN 1,2-dihydroxy-3-keto-5-methylthiopentene di... 29 8.4
sp|P0C6R3|ESTHL_BOVIN Carboxylesterase UNQ440/PRO873 homolog OS=... 29 8.4
sp|Q4WVG8|DNLI4_ASPFU DNA ligase 4 OS=Aspergillus fumigatus GN=l... 29 8.4

>sp|Q5ZL43|MTND_CHICK 1,2-dihydroxy-3-keto-5-methylthiopentene
dioxygenase OS=Gallus gallus GN=ADI1 PE=2 SV=1
Length = 180

Score = 35.8 bits (81), Expect = 0.069
Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
Frame = -2

Query: 259 DIVVHKGGQLPSYPRVDKDDHEEEVDITDAYTMMFDGA-YRKVLQKASGGVVIKNPKGDV 83
DIV +LP+Y K +EE + + D + DG+ Y V K + I KGD+
Sbjct: 65 DIVTIHKDKLPNYEEKIKTFYEEHLHLDDEIRYILDGSGYFDVRDKDDKWIRISMEKGDM 124

Query: 82 IFSRA--YNLDEAESNNEAEYLTLFLG 8
I A Y+ + NN + + LF+G
Sbjct: 125 ITLPAGIYHRFTLDENNYVKAMRLFVG 151


>sp|Q9BV57|MTND_HUMAN 1,2-dihydroxy-3-keto-5-methylthiopentene
dioxygenase OS=Homo sapiens GN=ADI1 PE=1 SV=1
Length = 179

Score = 30.8 bits (68), Expect = 2.2
Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 3/87 (3%)
Frame = -2

Query: 259 DIVVHKGGQLPSYPRVDKDDHEEEVDITDAYTMMFDGA-YRKVLQKASGGVVIKNPKGDV 83
DI+ +LP+Y K +EE + + D + DG+ Y V K + I KGD+
Sbjct: 65 DIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDM 124

Query: 82 IFSRA--YNLDEAESNNEAEYLTLFLG 8
+ A Y+ + N + + LF+G
Sbjct: 125 VTLPAGIYHRFTVDEKNYTKAMRLFVG 151


>sp|P21919|SOML_GADMO Somatolactin OS=Gadus morhua PE=1 SV=2
Length = 235

Score = 30.4 bits (67), Expect = 2.9
Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
Frame = +2

Query: 104 NDYPTTCLLKNFPVCTIKHHCIRICNIYFLF-MIILVNPWVRWKLPPLMY 250
N TC+ K+FP+ T K+ +I + + L +++LV W+ PL+Y
Sbjct: 85 NQAGNTCITKDFPIPTSKNELQQISDTWLLHSVLMLVQSWIE----PLVY 130


>sp|Q975J9|RL18_SULTO 50S ribosomal protein L18P OS=Sulfolobus
tokodaii GN=rpl18p PE=3 SV=1
Length = 196

Score = 29.3 bits (64), Expect = 6.4
Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 12/85 (14%)
Frame = -2

Query: 229 PSYPRVDKDDHEEEVDITDAYTMMFDGAYRKVLQKASGGVVIK----NPKGDVIFSRAYN 62
P+Y + E + + YT + + R V++ + ++ + NPKGDVI A++
Sbjct: 5 PNYRVKYRRRREGKTNYYKRYTYVINNTTRLVVRLTNKYIIAQIAKFNPKGDVIVVAAHS 64

Query: 61 LDEAE--------SNNEAEYLTLFL 11
++ A+ +N A YLT +L
Sbjct: 65 MELAKKFGWKGDLNNTPAAYLTGYL 89


>sp|Q5F3F2|MYSM1_CHICK Protein MYSM1 OS=Gallus gallus GN=MYSM1 PE=2
SV=1
Length = 832

Score = 29.3 bits (64), Expect = 6.4
Identities = 12/41 (29%), Positives = 26/41 (63%)
Frame = -2

Query: 217 RVDKDDHEEEVDITDAYTMMFDGAYRKVLQKASGGVVIKNP 95
+++K +EEVDITD +F A+++ + K+ ++ ++P
Sbjct: 213 KIEKLSDDEEVDITDDMDELFSPAFQQGVGKSELSIISESP 253


>sp|Q6PBX5|MTND_DANRE 1,2-dihydroxy-3-keto-5-methylthiopentene
dioxygenase OS=Danio rerio GN=adi1 PE=2 SV=1
Length = 181

Score = 29.3 bits (64), Expect = 6.4
Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 3/87 (3%)
Frame = -2

Query: 259 DIVVHKGGQLPSYPRVDKDDHEEEVDITDAYTMMFDG-AYRKVLQKASGGVVIKNPKGDV 83
DI+ +LP Y K +EE + + D + +G +Y V + + I KGD+
Sbjct: 68 DIITIHPDKLPDYQNKLKMFYEEHLHLDDEIRYILEGSSYFDVRDEGDRWIRIAVSKGDL 127

Query: 82 IFSRA--YNLDEAESNNEAEYLTLFLG 8
I A Y+ + +N + + LF+G
Sbjct: 128 ITLPAGIYHRFTVDESNYTKAMRLFVG 154


>sp|P97855|G3BP1_MOUSE Ras GTPase-activating protein-binding protein
1 OS=Mus musculus GN=G3bp1 PE=1 SV=1
Length = 465

Score = 29.3 bits (64), Expect = 6.4
Identities = 14/43 (32%), Positives = 24/43 (55%)
Frame = -2

Query: 268 NLADIVVHKGGQLPSYPRVDKDDHEEEVDITDAYTMMFDGAYR 140
N+ ++ ++ GG+LP++ V DD E + +MF GA R
Sbjct: 363 NVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGAVR 405


>sp|Q9YTU2|POLB_CHPVU ORFB polyprotein OS=Cryphonectria hypovirus 1
(strain Euro7) PE=3 SV=1
Length = 3164

Score = 28.9 bits (63), Expect = 8.4
Identities = 18/63 (28%), Positives = 28/63 (44%)
Frame = -2

Query: 259 DIVVHKGGQLPSYPRVDKDDHEEEVDITDAYTMMFDGAYRKVLQKASGGVVIKNPKGDVI 80
D+VVHKG + +P D+ +E+ V + DG + +G +K P G
Sbjct: 2897 DVVVHKGRLITPHPYTDEKTNEQRV---NRVGRTMDGVVIQPQLAGTGDPPVKYPSGIFF 2953

Query: 79 FSR 71
SR
Sbjct: 2954 SSR 2956


>sp|Q3ZBL1|MTND_BOVIN 1,2-dihydroxy-3-keto-5-methylthiopentene
dioxygenase OS=Bos taurus GN=ADI1 PE=2 SV=1
Length = 179

Score = 28.9 bits (63), Expect = 8.4
Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 3/87 (3%)
Frame = -2

Query: 259 DIVVHKGGQLPSYPRVDKDDHEEEVDITDAYTMMFDGA-YRKVLQKASGGVVIKNPKGDV 83
DI+ +LP+Y K EE + + + + DG+ Y V + + I KGD+
Sbjct: 65 DIITISKDKLPNYEEKIKMFFEEHLHLDEEIRYILDGSGYFDVRDQEDRWIRISMEKGDM 124

Query: 82 IFSRA--YNLDEAESNNEAEYLTLFLG 8
I A Y+ + N + + LF+G
Sbjct: 125 ITLPAGIYHRFTLDEKNYVKAMRLFVG 151


>sp|P0C6R3|ESTHL_BOVIN Carboxylesterase UNQ440/PRO873 homolog OS=Bos
taurus PE=2 SV=1
Length = 550

Score = 28.9 bits (63), Expect = 8.4
Identities = 14/38 (36%), Positives = 22/38 (57%)
Frame = -2

Query: 271 ANLADIVVHKGGQLPSYPRVDKDDHEEEVDITDAYTMM 158
AN A GG+LP +PR +KD+ ++D+T +M
Sbjct: 498 ANFARTGNPNGGKLPYWPRYNKDEKYLQLDLTTRVGVM 535


tr_hit_id Q9FE41
Definition tr|Q9FE41|Q9FE41_ORYSJ Similar to Arabidopsis thaliana chromosome II BAC F26H6 OS=Oryza sativa subsp. japonica
Align length 75
Score (bit) 46.6
E-value 0.0006
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916961|Adiantum capillus-veneris mRNA, clone:
YMU001_000094_A09.
(272 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9FE41|Q9FE41_ORYSJ Similar to Arabidopsis thaliana chromosom... 47 6e-04
tr|A2ZPJ1|A2ZPJ1_ORYSJ Putative uncharacterized protein OS=Oryza... 47 6e-04
tr|A3BZC3|A3BZC3_ORYSJ Putative uncharacterized protein OS=Oryza... 45 0.002
tr|Q93Y69|Q93Y69_ORYSJ Putative gag-pol OS=Oryza sativa subsp. j... 43 0.009
tr|Q10I89|Q10I89_ORYSJ Retrotransposon protein, putative, unclas... 43 0.009
tr|A3AJK6|A3AJK6_ORYSJ Putative uncharacterized protein OS=Oryza... 43 0.009
tr|Q850X9|Q850X9_ORYSJ Putative gag-pol OS=Oryza sativa subsp. j... 42 0.015
tr|Q10B57|Q10B57_ORYSJ Retrotransposon protein, putative, unclas... 42 0.015
tr|Q8RUA1|Q8RUA1_ORYSJ Putative gag-pol polyprotein OS=Oryza sat... 42 0.020
tr|Q53M61|Q53M61_ORYSJ Retrotransposon protein, putative, Ty3-gy... 42 0.020
tr|Q33BC5|Q33BC5_ORYSJ Transposon protein, putative, unclassifie... 42 0.020
tr|Q2R6D6|Q2R6D6_ORYSJ Retrotransposon protein, putative, Ty3-gy... 42 0.020
tr|Q2R4V4|Q2R4V4_ORYSJ Retrotransposon protein, putative, Ty3-gy... 40 0.044
tr|Q0J6G5|Q0J6G5_ORYSJ Os08g0322200 protein OS=Oryza sativa subs... 40 0.044
tr|Q94HB8|Q94HB8_ORYSJ Putative retroelement OS=Oryza sativa sub... 40 0.075
tr|Q338P2|Q338P2_ORYSJ Retrotransposon protein, putative, Ty3-gy... 40 0.075
tr|Q2R286|Q2R286_ORYSJ Retrotransposon protein, putative, Ty3-gy... 40 0.075
tr|Q8S5K6|Q8S5K6_ORYSJ Putative retroelement (Transposon protein... 39 0.098
tr|Q7XWQ1|Q7XWQ1_ORYSJ OSJNBa0072D08.10 protein OS=Oryza sativa ... 39 0.098
tr|Q2QMY6|Q2QMY6_ORYSJ Retrotransposon protein, putative, unclas... 39 0.098
tr|B6Y3C7|B6Y3C7_ANATH Ribonuclease H OS=Anaerocellum thermophil... 39 0.13
tr|Q8S6P3|Q8S6P3_ORYSJ Putative polyprotein OS=Oryza sativa subs... 39 0.13
tr|Q8LNS0|Q8LNS0_ORYSJ Putative gag-pol (Transposon protein, put... 39 0.13
tr|Q8LMA8|Q8LMA8_ORYSJ Putative retroelement (Transposon protein... 39 0.13
tr|Q8H872|Q8H872_ORYSJ Putative polyprotein OS=Oryza sativa subs... 39 0.13
tr|Q7XSL9|Q7XSL9_ORYSJ OSJNBa0035O13.7 protein OS=Oryza sativa s... 39 0.13
tr|Q7G4J7|Q7G4J7_ORYSJ Retrotransposon protein, putative, Ty3-gy... 39 0.13
tr|Q7G3E1|Q7G3E1_ORYSJ Transposon protein, putative, unclassifie... 39 0.13
tr|Q75IY3|Q75IY3_ORYSJ Retrotransposon protein, putative, Ty3-gy... 39 0.13
tr|Q75IX6|Q75IX6_ORYSJ Putative polyprotein OS=Oryza sativa subs... 39 0.13

>tr|Q9FE41|Q9FE41_ORYSJ Similar to Arabidopsis thaliana chromosome II
BAC F26H6 OS=Oryza sativa subsp. japonica PE=4 SV=1
Length = 2876

Score = 46.6 bits (109), Expect = 6e-04
Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 10/75 (13%)
Frame = -2

Query: 196 EEEV---DITDAYTMMFDGAYRKVL-------QKASGGVVIKNPKGDVIFSRAYNLDEAE 47
+EE+ ++ + + + FDGA RK + ++A G+V K P+G VI+ L E
Sbjct: 2270 DEEIFTAELQEQWELYFDGASRKDINPDGTPRRRAGAGLVFKTPQGGVIYHSFSLLKEEC 2329

Query: 46 SNNEAEYLTLFLGLM 2
SNNEAEY L GL+
Sbjct: 2330 SNNEAEYEALIFGLL 2344


>tr|A2ZPJ1|A2ZPJ1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_000463 PE=4 SV=1
Length = 2275

Score = 46.6 bits (109), Expect = 6e-04
Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 10/75 (13%)
Frame = -2

Query: 196 EEEV---DITDAYTMMFDGAYRKVL-------QKASGGVVIKNPKGDVIFSRAYNLDEAE 47
+EE+ ++ + + + FDGA RK + ++A G+V K P+G VI+ L E
Sbjct: 1938 DEEIFTAELQEQWELYFDGASRKDINPDGTPRRRAGAGLVFKTPQGGVIYHSFSLLKEEC 1997

Query: 46 SNNEAEYLTLFLGLM 2
SNNEAEY L GL+
Sbjct: 1998 SNNEAEYEALIFGLL 2012


>tr|A3BZC3|A3BZC3_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_028395 PE=4 SV=1
Length = 1549

Score = 44.7 bits (104), Expect = 0.002
Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 7/94 (7%)
Frame = -2

Query: 262 ADIVVHKGGQLPSYPRVDKDDHEEEVDITDAYTMMFDGAYRKVL-------QKASGGVVI 104
A I + + +LP P + + +E+ + + FDGA RK + ++A G+V
Sbjct: 1096 AGINLQRNNRLPPPPAIFTAELQEQ------WELYFDGASRKDVNPDGTPRRRAGAGLVF 1149

Query: 103 KNPKGDVIFSRAYNLDEAESNNEAEYLTLFLGLM 2
K P+ VI+ L E SNNEAEY L GL+
Sbjct: 1150 KTPQRGVIYHSFSLLKEECSNNEAEYEALIFGLL 1183


>tr|Q93Y69|Q93Y69_ORYSJ Putative gag-pol OS=Oryza sativa subsp.
japonica GN=OSJNBb0031G04.9 PE=4 SV=1
Length = 1262

Score = 42.7 bits (99), Expect = 0.009
Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 7/75 (9%)
Frame = -2

Query: 205 DDHEEEVDITDAYTMMFDGAYRKV-------LQKASGGVVIKNPKGDVIFSRAYNLDEAE 47
D+ ++ ++ + FDGA R ++A G+V K P+G VI+ L E
Sbjct: 724 DEDVFTIETEPSWELCFDGASRTENDRDGTPRKRAGAGLVFKTPQGGVIYHSFSLLKEEC 783

Query: 46 SNNEAEYLTLFLGLM 2
SNNEAEY L GL+
Sbjct: 784 SNNEAEYEALIFGLL 798


>tr|Q10I89|Q10I89_ORYSJ Retrotransposon protein, putative,
unclassified OS=Oryza sativa subsp. japonica
GN=LOC_Os03g36220 PE=4 SV=1
Length = 1269

Score = 42.7 bits (99), Expect = 0.009
Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 7/75 (9%)
Frame = -2

Query: 205 DDHEEEVDITDAYTMMFDGAYRKV-------LQKASGGVVIKNPKGDVIFSRAYNLDEAE 47
D+ ++ ++ + FDGA R ++A G+V K P+G VI+ L E
Sbjct: 731 DEDVFTIETEPSWELCFDGASRTENDRDGTPRKRAGAGLVFKTPQGGVIYHSFSLLKEEC 790

Query: 46 SNNEAEYLTLFLGLM 2
SNNEAEY L GL+
Sbjct: 791 SNNEAEYEALIFGLL 805


>tr|A3AJK6|A3AJK6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_010978 PE=4 SV=1
Length = 371

Score = 42.7 bits (99), Expect = 0.009
Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 7/75 (9%)
Frame = -2

Query: 205 DDHEEEVDITDAYTMMFDGAYRKV-------LQKASGGVVIKNPKGDVIFSRAYNLDEAE 47
D+ ++ ++ + FDGA R ++A G+V K P+G VI+ L E
Sbjct: 102 DEDVFTIETEPSWELCFDGASRTENDRDGTPRKRAGAGLVFKTPQGGVIYHSFSLLKEEC 161

Query: 46 SNNEAEYLTLFLGLM 2
SNNEAEY L GL+
Sbjct: 162 SNNEAEYEALIFGLL 176


>tr|Q850X9|Q850X9_ORYSJ Putative gag-pol OS=Oryza sativa subsp.
japonica GN=OSJNBb0027B08.26 PE=4 SV=1
Length = 1635

Score = 42.0 bits (97), Expect = 0.015
Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
Frame = -2

Query: 208 KDDHEEEVDITDAYTMM-FDGAYRKVLQKASGGVVIKNPKGDVIFSRAYNLDEAESNNEA 32
+++ + DI D + +M FDG+ LQ AS GV + +P GDV+ LD +NN A
Sbjct: 1069 EEEEDPNADIRDGHWVMHFDGSLN--LQGASAGVTLTSPNGDVL-KYVVRLDFRATNNMA 1125

Query: 31 EYLTLFLGL 5
EY L GL
Sbjct: 1126 EYEGLLAGL 1134


>tr|Q10B57|Q10B57_ORYSJ Retrotransposon protein, putative,
unclassified OS=Oryza sativa subsp. japonica
GN=LOC_Os03g61400 PE=4 SV=1
Length = 1629

Score = 42.0 bits (97), Expect = 0.015
Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
Frame = -2

Query: 208 KDDHEEEVDITDAYTMM-FDGAYRKVLQKASGGVVIKNPKGDVIFSRAYNLDEAESNNEA 32
+++ + DI D + +M FDG+ LQ AS GV + +P GDV+ LD +NN A
Sbjct: 1063 EEEEDPNADIRDGHWVMHFDGSLN--LQGASAGVTLTSPNGDVL-KYVVRLDFRATNNMA 1119

Query: 31 EYLTLFLGL 5
EY L GL
Sbjct: 1120 EYEGLLAGL 1128


>tr|Q8RUA1|Q8RUA1_ORYSJ Putative gag-pol polyprotein OS=Oryza sativa
subsp. japonica GN=OSJNBa0049K09.1 PE=4 SV=1
Length = 489

Score = 41.6 bits (96), Expect = 0.020
Identities = 24/57 (42%), Positives = 32/57 (56%)
Frame = -2

Query: 175 DAYTMMFDGAYRKVLQKASGGVVIKNPKGDVIFSRAYNLDEAESNNEAEYLTLFLGL 5
+ +TM FDGA+ Q A G ++ P GD F A +LD +NN AEY L +GL
Sbjct: 127 ETWTMAFDGAFNS--QGAGAGFILTAPTGDQ-FKHAIHLDFRATNNTAEYEGLLVGL 180


>tr|Q53M61|Q53M61_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
sub-class OS=Oryza sativa subsp. japonica
GN=LOC_Os11g20420 PE=4 SV=1
Length = 787

Score = 41.6 bits (96), Expect = 0.020
Identities = 23/67 (34%), Positives = 37/67 (55%)
Frame = -2

Query: 205 DDHEEEVDITDAYTMMFDGAYRKVLQKASGGVVIKNPKGDVIFSRAYNLDEAESNNEAEY 26
D+ + ++ +TM FDGA+ Q A G ++ +P GD F A +L+ +NN AEY
Sbjct: 237 DNRSDSQTDSETWTMAFDGAFNS--QGAGTGFILTSPSGDQ-FKHAIHLNFRATNNTAEY 293

Query: 25 LTLFLGL 5
L +G+
Sbjct: 294 EGLLIGI 300