BP916981
Clone id YMU001_000094_C07
Library
Length 270
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000094_C07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAGTGATATCAAAAGCATACATGAATTTACCTCTGTAGATAGTCAACAAAACTTCACACT
TGAAAGCACAGCCAGTAGCATCCACGAACCTAAAAAGCTTTTCTTTGTTCTTTGGAGTTG
GGGGCATCCGCAACAAACTTGCAACGCATCATTCCCTACATTCTTACAGAGATAAATCAC
TGAGCTTCTCCATCTTTGTGTGCATTCCTGCAACCCTAGTTCTAACAATTGGTATCAGAG
CAGGCTTTCCAGCATACCCTTCATCAAAAG
■■Homology search results ■■ -
sp_hit_id Q8NEG5
Definition sp|Q8NEG5|ZSWM2_HUMAN Zinc finger SWIM domain-containing protein 2 OS=Homo sapiens
Align length 43
Score (bit) 29.3
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916981|Adiantum capillus-veneris mRNA, clone:
YMU001_000094_C07.
(270 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8NEG5|ZSWM2_HUMAN Zinc finger SWIM domain-containing protein... 29 6.4

>sp|Q8NEG5|ZSWM2_HUMAN Zinc finger SWIM domain-containing protein 2
OS=Homo sapiens GN=ZSWIM2 PE=1 SV=1
Length = 633

Score = 29.3 bits (64), Expect = 6.4
Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%)
Frame = +3

Query: 6 ISKAYMNLPL*IVNKTSHLKAQPVA-STNLKSFSLFFGVGGIR 131
+SK Y N I K SHL QPV+ S N KS L + G++
Sbjct: 590 LSKRYSNCMGEITRKCSHLSRQPVSHSVNTKSTELSLIIEGVQ 632


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP916981|Adiantum capillus-veneris mRNA, clone:
YMU001_000094_C07.
(270 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******