BP917004
Clone id YMU001_000094_F04
Library
Length 508
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000094_F04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGTCTGTGGTTACGCCAACTTGATGACAAGCCTGCTCCAAAAGAACATTTGCTGTTCCTA
TAGCAGTATCCGCTTTCAGGCCAACAACAATTTGAAGAGGTTTGTCAGAGGCTGCAGTCA
TCATAAAAGAATCAGTTTCTTGCCGCAAAACATCTTTGGAGTTTGCAGTAGAGGACGGGG
CAAGCGCACCCATTGCAGAAGGGGTGAGAGGAGCGGGAGGCCAGTGTTGGAAGATGTCCG
AGCAATCATCCAATGGGTATTGCAGCCAAGTAACAAGCTCATCATCAGTGAAAGGACTCT
GATGACAGCTCTTTGCATTAACGATGCTATCGTTTTTACTGCTAAGGAAAGCAAGATTAT
CTAGCCTATCAAGAGGCTGATTTTGAATTGTCTCATGGTCTTCTTCTTCATCTTGCTTAT
CAGAAAATCTGTGCCCACCTGCCTGCTCAGACATATCTCCGAACTAGCCCTTCTTTCTCT
TGAATTTCTGCAGAGGGTCGTAATGGGT
■■Homology search results ■■ -
sp_hit_id Q8GZM7
Definition sp|Q8GZM7|PIF1_ARATH Transcription factor PIF1 OS=Arabidopsis thaliana
Align length 59
Score (bit) 32.3
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917004|Adiantum capillus-veneris mRNA, clone:
YMU001_000094_F04.
(508 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8GZM7|PIF1_ARATH Transcription factor PIF1 OS=Arabidopsis th... 32 1.3
sp|Q9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains prot... 32 1.7
sp|Q92J87|RL7_RICCN 50S ribosomal protein L7/L12 OS=Rickettsia c... 31 2.9
sp|Q5RDC8|K0528_PONAB Uncharacterized protein KIAA0528 homolog O... 31 2.9
sp|Q12226|AYT1_YEAST Trichothecene 3-O-acetyltransferase OS=Sacc... 31 3.9
sp|Q9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains pr... 30 5.0
sp|Q47LI4|RL7_THEFY 50S ribosomal protein L7/L12 OS=Thermobifida... 30 5.0
sp|Q84LH8|PIF5_ARATH Transcription factor PIF5 OS=Arabidopsis th... 30 5.0
sp|O14772|FPGT_HUMAN Fucose-1-phosphate guanylyltransferase OS=H... 30 5.0
sp|Q28C44|C19L2_XENTR CWF19-like protein 2 OS=Xenopus tropicalis... 30 5.0
sp|A1KQY9|K118A_POLSE Keratin, type I cytoskeletal 18-A OS=Polyp... 30 6.5
sp|A1YPR0|ZBT7C_HUMAN Zinc finger and BTB domain-containing prot... 30 6.6
sp|Q9FY06|PPF1_PEA Inner membrane protein PPF-1, chloroplastic O... 30 8.6
sp|O95427|PIGN_HUMAN GPI ethanolamine phosphate transferase 1 OS... 30 8.6

>sp|Q8GZM7|PIF1_ARATH Transcription factor PIF1 OS=Arabidopsis
thaliana GN=PIF1 PE=1 SV=1
Length = 478

Score = 32.3 bits (72), Expect = 1.3
Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 4/59 (6%)
Frame = -1

Query: 286 DDELVTWLQYPLDD---CSD-IFQHWPPAPLTPSAMGALAPSSTANSKDVLRQETDSFM 122
+DE+ +WL YPL D CSD +F P A T + A +S + R +FM
Sbjct: 88 EDEMTSWLHYPLRDDDFCSDLLFSAAPTATATATVSQVTAARPPVSSTNESRPPVRNFM 146


>sp|Q9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1
OS=Rattus norvegicus GN=Shank1 PE=1 SV=1
Length = 2167

Score = 32.0 bits (71), Expect = 1.7
Identities = 23/73 (31%), Positives = 32/73 (43%)
Frame = -1

Query: 310 SCHQSPFTDDELVTWLQYPLDDCSDIFQHWPPAPLTPSAMGALAPSSTANSKDVLRQETD 131
S + ++D + L P S IFQ+WP PL P G+ SSTA +
Sbjct: 1924 SLQRQRLSEDSQTSLLSKP---SSSIFQNWPKPPLPPLPTGSGVSSSTAAAPGATSPSAS 1980

Query: 130 SFMMTAASDKPLQ 92
S +AS + LQ
Sbjct: 1981 S---ASASTRHLQ 1990


>sp|Q92J87|RL7_RICCN 50S ribosomal protein L7/L12 OS=Rickettsia
conorii GN=rplL PE=3 SV=2
Length = 125

Score = 31.2 bits (69), Expect = 2.9
Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 2/64 (3%)
Frame = -1

Query: 214 APLTPSAMGALAPSSTANSKDVLRQETDSFMMTAASDKPLQIVVGLKADTAIG--TANVL 41
AP+ +A+GA AP++ A V + ++TAA DK ++++ +K T +G A L
Sbjct: 36 APVAVAAVGAAAPAAEA----VAEKTEFEVVLTAAGDKKVEVIKVVKDITGLGLIEAKKL 91

Query: 40 LEQA 29
+++A
Sbjct: 92 VDEA 95


>sp|Q5RDC8|K0528_PONAB Uncharacterized protein KIAA0528 homolog
OS=Pongo abelii PE=2 SV=1
Length = 1000

Score = 31.2 bits (69), Expect = 2.9
Identities = 22/90 (24%), Positives = 37/90 (41%)
Frame = -1

Query: 313 KSCHQSPFTDDELVTWLQYPLDDCSDIFQHWPPAPLTPSAMGALAPSSTANSKDVLRQET 134
KS ++ ++EL LQ+PL+ CSD F P P + +P N ++
Sbjct: 811 KSLQRASTDNEEL---LQFPLELCSDSFPSHPFPPAKAVTVERASPVGDGNFRNRSAPPC 867

Query: 133 DSFMMTAASDKPLQIVVGLKADTAIGTANV 44
+ + PL + G K +G N+
Sbjct: 868 ANSTVGVVKMTPLSFIPGAKITKYLGIINM 897


>sp|Q12226|AYT1_YEAST Trichothecene 3-O-acetyltransferase
OS=Saccharomyces cerevisiae GN=AYT1 PE=1 SV=1
Length = 474

Score = 30.8 bits (68), Expect = 3.9
Identities = 13/22 (59%), Positives = 18/22 (81%), Gaps = 2/22 (9%)
Frame = -1

Query: 331 DSIVNA--KSCHQSPFTDDELV 272
+SI+N KSCHQ PF+D+EL+
Sbjct: 182 ESIINLLNKSCHQKPFSDEELL 203


>sp|Q9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein
1 OS=Homo sapiens GN=SHANK1 PE=1 SV=1
Length = 2161

Score = 30.4 bits (67), Expect = 5.0
Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 12/76 (15%)
Frame = -1

Query: 310 SCHQSPFTDDELVTWLQYPLDDCSDIFQHWPPAPLTP------------SAMGALAPSST 167
S + +DD + L P+ S +FQ+WP PL P +A GA +PS++
Sbjct: 1918 SLQRQRLSDDSQSSLLSKPV---SSLFQNWPKPPLPPLPTGTGVSPTAAAAPGATSPSAS 1974

Query: 166 ANSKDVLRQETDSFMM 119
++S + F M
Sbjct: 1975 SSSTSTRHLQGVEFEM 1990


>sp|Q47LI4|RL7_THEFY 50S ribosomal protein L7/L12 OS=Thermobifida
fusca (strain YX) GN=rplL PE=3 SV=1
Length = 130

Score = 30.4 bits (67), Expect = 5.0
Identities = 22/90 (24%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
Frame = -1

Query: 316 AKSCHQSPFTDDELVTWLQYPLDDCSDIFQH-WPPAPLTPSAMGALAPSSTANSKDVLRQ 140
AK H+ + E +T L+ L + +F+ + P+A+ A AP+ + + +
Sbjct: 2 AKLSHEELLSAFEEMTLLE--LSEFVKLFEEKFDVTAAAPAAVVAAAPAGGGGGEAAVEE 59

Query: 139 ETDSF--MMTAASDKPLQIVVGLKADTAIG 56
E D F ++ +A DK +Q++ ++ T +G
Sbjct: 60 EKDEFDVILESAGDKKIQVIKEVRGLTNLG 89


>sp|Q84LH8|PIF5_ARATH Transcription factor PIF5 OS=Arabidopsis
thaliana GN=PIF5 PE=1 SV=1
Length = 444

Score = 30.4 bits (67), Expect = 5.0
Identities = 21/78 (26%), Positives = 33/78 (42%)
Frame = -1

Query: 460 GDMSEQAGGHRFSDKQDEEEDHETIQNQPLDRLDNLAFLSSKNDSIVNAKSCHQSPFTDD 281
G + Q+ R Q + ET++ LDN + N + ++ D
Sbjct: 37 GQVVLQSQARREPSVQVQTHKQETLRKPNNIFLDNQETVQKPNYAALD----------DQ 86

Query: 280 ELVTWLQYPLDDCSDIFQ 227
E V+W+QYP DD D F+
Sbjct: 87 ETVSWIQYPPDDVIDPFE 104


>sp|O14772|FPGT_HUMAN Fucose-1-phosphate guanylyltransferase OS=Homo
sapiens GN=FPGT PE=1 SV=2
Length = 594

Score = 30.4 bits (67), Expect = 5.0
Identities = 16/44 (36%), Positives = 24/44 (54%)
Frame = +2

Query: 35 LQKNICCSYSSIRFQANNNLKRFVRGCSHHKRISFLPQNIFGVC 166
L+ N C Y+++ F +NLK+ V+ S K + F FGVC
Sbjct: 458 LKMNRCLKYATMAFGVQDNLKKSVKTLSDIKLLQF-----FGVC 496


>sp|Q28C44|C19L2_XENTR CWF19-like protein 2 OS=Xenopus tropicalis
GN=cwf19l2 PE=2 SV=1
Length = 922

Score = 30.4 bits (67), Expect = 5.0
Identities = 9/28 (32%), Positives = 19/28 (67%)
Frame = -1

Query: 319 NAKSCHQSPFTDDELVTWLQYPLDDCSD 236
++K C Q P ++++ ++W + P DCS+
Sbjct: 395 SSKPCFQKPLSNEDEISWKKVPSKDCSE 422


tr_hit_id A9SDX1
Definition tr|A9SDX1|A9SDX1_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 47
Score (bit) 38.1
E-value 0.25
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917004|Adiantum capillus-veneris mRNA, clone:
YMU001_000094_F04.
(508 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SDX1|A9SDX1_PHYPA Predicted protein OS=Physcomitrella paten... 38 0.25
tr|A9SDJ0|A9SDJ0_PHYPA Predicted protein OS=Physcomitrella paten... 37 0.42
tr|Q68E78|Q68E78_AERPU DNA topoisomerase OS=Aeromonas punctata G... 36 0.94
tr|Q209L9|Q209L9_AERHY DNA topoisomerase OS=Aeromonas hydrophila... 36 0.94
tr|A3LUA0|A3LUA0_PICST Transcriptional accessory protein involve... 36 1.2
tr|A7PJR3|A7PJR3_VITVI Chromosome chr12 scaffold_18, whole genom... 35 1.6
tr|A5AGT8|A5AGT8_VITVI Putative uncharacterized protein OS=Vitis... 35 2.1
tr|Q4WLS1|Q4WLS1_ASPFU Translation initiation factor eif-2b epsi... 35 2.1
tr|B0Y8T9|B0Y8T9_ASPFC Translation initiation factor eif-2b epsi... 35 2.1
tr|A5AZT1|A5AZT1_VITVI Putative uncharacterized protein OS=Vitis... 35 2.7
tr|Q0CV75|Q0CV75_ASPTN Putative uncharacterized protein OS=Asper... 35 2.7
tr|A8R966|A8R966_9FIRM Putative uncharacterized protein OS=Eubac... 34 3.6
tr|A1DNX7|A1DNX7_NEOFI Translation initiation factor eif-2b epsi... 34 3.6
tr|Q22A16|Q22A16_TETTH Putative uncharacterized protein OS=Tetra... 34 4.7
tr|A9THQ7|A9THQ7_PHYPA Predicted protein OS=Physcomitrella paten... 33 6.1
tr|A8PPV1|A8PPV1_BRUMA Angiotensin-converting enzyme family prot... 33 6.1
tr|A8PPU9|A8PPU9_BRUMA Angiotensin-converting enzyme family prot... 33 6.1
tr|A2RN85|A2RN85_LACLM Putative uncharacterized protein OS=Lacto... 33 7.8

>tr|A9SDX1|A9SDX1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_164436 PE=4 SV=1
Length = 801

Score = 38.1 bits (87), Expect = 0.25
Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 6/47 (12%)
Frame = -1

Query: 334 NDSIVNAKSCHQSPFTDDELVTWLQYPLDD------CSDIFQHWPPA 212
N++ H DE+V+WLQYPLDD CSD F P A
Sbjct: 190 NETATEPHPPHNIDVDSDEMVSWLQYPLDDTLERNYCSDFFGELPDA 236


>tr|A9SDJ0|A9SDJ0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_164347 PE=4 SV=1
Length = 1015

Score = 37.4 bits (85), Expect = 0.42
Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 2/37 (5%)
Frame = -1

Query: 334 NDSIVNAKSCHQSPFTDDELVTWLQYPLDD--CSDIF 230
N S H +DE+V+WLQYPLDD CSD F
Sbjct: 333 NGSNTAPNPVHNIDVDNDEMVSWLQYPLDDPFCSDFF 369


>tr|Q68E78|Q68E78_AERPU DNA topoisomerase OS=Aeromonas punctata
GN=top PE=3 SV=1
Length = 658

Score = 36.2 bits (82), Expect = 0.94
Identities = 19/56 (33%), Positives = 32/56 (57%)
Frame = -1

Query: 427 FSDKQDEEEDHETIQNQPLDRLDNLAFLSSKNDSIVNAKSCHQSPFTDDELVTWLQ 260
FSD ++E+D +T N P+ L LS++N ++N K+ S FT+ L+ L+
Sbjct: 402 FSDDTEDEDDKDTKANNPIPVLAPGQRLSAENGRVLNKKTRAPSRFTEASLIAELE 457


>tr|Q209L9|Q209L9_AERHY DNA topoisomerase OS=Aeromonas hydrophila
GN=top PE=3 SV=1
Length = 658

Score = 36.2 bits (82), Expect = 0.94
Identities = 19/56 (33%), Positives = 32/56 (57%)
Frame = -1

Query: 427 FSDKQDEEEDHETIQNQPLDRLDNLAFLSSKNDSIVNAKSCHQSPFTDDELVTWLQ 260
FSD ++E+D +T N P+ L LS++N ++N K+ S FT+ L+ L+
Sbjct: 402 FSDDTEDEDDKDTKANNPIPVLAPGQRLSAENGRVLNKKTRAPSRFTEASLIAELE 457


>tr|A3LUA0|A3LUA0_PICST Transcriptional accessory protein involved
in TBP (TATA-binding protein) regulation helicase MOT1
OS=Pichia stipitis GN=MOT1 PE=4 SV=2
Length = 1901

Score = 35.8 bits (81), Expect = 1.2
Identities = 31/120 (25%), Positives = 49/120 (40%), Gaps = 23/120 (19%)
Frame = -1

Query: 418 KQDEEEDHETI---QNQPLDRLDN--------------------LAFLSSKNDSIVNAKS 308
KQ+EEEDH I Q++ L +LDN L++K+D I + S
Sbjct: 105 KQEEEEDHIKIKLEQDEELQKLDNNLSSLVSFASFDLAEILKSGARLLATKSDEIPDPSS 164

Query: 307 CHQSPFTDDELVTWLQYPLDDCSDIFQHWPPAPLTPSAMGALAPSSTANSKDVLRQETDS 128
C ++ D+ +I +P TP A P+S ++L++ TDS
Sbjct: 165 CDENSLIGRIKKRKTSIIKDEEEEINSKSSASPPTPFASTPGTPTSAKAELNILKESTDS 224


>tr|A7PJR3|A7PJR3_VITVI Chromosome chr12 scaffold_18, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00018844001
PE=4 SV=1
Length = 437

Score = 35.4 bits (80), Expect = 1.6
Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 6/30 (20%)
Frame = -1

Query: 286 DDELVTWLQYPLDD------CSDIFQHWPP 215
D+E ++W+QYPLDD CS++F PP
Sbjct: 83 DEESISWIQYPLDDSLDKEFCSNLFMELPP 112


>tr|A5AGT8|A5AGT8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_009521 PE=4 SV=1
Length = 318

Score = 35.0 bits (79), Expect = 2.1
Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
Frame = +2

Query: 95 KRFVRGCSHHKRISFLPQ-NIFGVCSRGRGKRTHCRRGERSGRPVLEDVRAIIQWVLQPS 271
K+ CSHH + Q ++F V RG R C RGER + + + ++ + +Q S
Sbjct: 209 KKIQVACSHHPMCGKIFQMDVFQVEERGFYVRLACNRGERVAVSLYKALESLTGFXIQSS 268

Query: 272 NKLIISERTLMT 307
N SE ++T
Sbjct: 269 NLATFSETFVLT 280


>tr|Q4WLS1|Q4WLS1_ASPFU Translation initiation factor eif-2b epsilon
subunit, putative OS=Aspergillus fumigatus
GN=AFUA_6G12530 PE=4 SV=1
Length = 767

Score = 35.0 bits (79), Expect = 2.1
Identities = 36/126 (28%), Positives = 58/126 (46%), Gaps = 2/126 (1%)
Frame = -1

Query: 454 MSEQAGGHRFSDKQDEEEDHETIQNQPLDRLDNLAFLSSKNDSIVNAKSCHQSPFTDDEL 275
+ E GH + ++DE+ED +T+ N + N+A LS +SI + S S F
Sbjct: 514 VGEGGEGHEYFQEEDEDED-DTVSNASSGLVYNMAQLSLSTESI-STLSSEMSHFGGSRS 571

Query: 274 VTW-LQYPLDDCSDIFQHWPPAPLTPSAMGALAPSSTANSKDVLRQETDSFMMTA-ASDK 101
++ Y D+ +D F H A + S + + DV++ E S MTA ASD
Sbjct: 572 ESFGTSYSEDEDADHFVHDAAASVYDSLKDGV-------TSDVVQLELVSLRMTANASDH 624

Query: 100 PLQIVV 83
++ V
Sbjct: 625 QVRRAV 630


>tr|B0Y8T9|B0Y8T9_ASPFC Translation initiation factor eif-2b epsilon
subunit, putative OS=Aspergillus fumigatus (strain CEA10
/ CBS 144.89 / FGSC A1163) GN=AFUB_078530 PE=4 SV=1
Length = 767

Score = 35.0 bits (79), Expect = 2.1
Identities = 36/126 (28%), Positives = 58/126 (46%), Gaps = 2/126 (1%)
Frame = -1

Query: 454 MSEQAGGHRFSDKQDEEEDHETIQNQPLDRLDNLAFLSSKNDSIVNAKSCHQSPFTDDEL 275
+ E GH + ++DE+ED +T+ N + N+A LS +SI + S S F
Sbjct: 514 VGEGGEGHEYFQEEDEDED-DTVSNASSGLVYNMAQLSLSTESI-STLSSEMSHFGGSRS 571

Query: 274 VTW-LQYPLDDCSDIFQHWPPAPLTPSAMGALAPSSTANSKDVLRQETDSFMMTA-ASDK 101
++ Y D+ +D F H A + S + + DV++ E S MTA ASD
Sbjct: 572 ESFGTSYSEDEDADHFVHDAAASVYDSLKDGV-------TSDVVQLELVSLRMTANASDH 624

Query: 100 PLQIVV 83
++ V
Sbjct: 625 QVRRAV 630


>tr|A5AZT1|A5AZT1_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_023382 PE=4 SV=1
Length = 627

Score = 34.7 bits (78), Expect = 2.7
Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 6/69 (8%)
Frame = -1

Query: 415 QDEEEDHETIQNQPLDRLDNLAFLSSKNDSIVNAKSCHQSPFTDDELVTWLQYPLDD--- 245
+D++ H T N + + ++ F+ ND ++ S DD++V WL YP+D+
Sbjct: 68 RDKDTGHGT--NSKMGKFGSMDFIL--NDFPLSVPSAEMGLSQDDDMVPWLNYPIDESLQ 123

Query: 244 ---CSDIFQ 227
CSD Q
Sbjct: 124 HDYCSDFLQ 132