BP917006
Clone id YMU001_000094_F06
Library
Length 431
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000094_F06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ACAGCTTTCAAGGCTCCAGAAATGTTAGTGGTGGATTCAAAGTCTTTTGCCAGCATGGTT
TAGGGGCAAAACCACTCTTGGAGGCGTTTTCTGGAGCCGCTTAATTCGGCCAAGTATGGG
AAAAGCCTCATCACATGTTTCTGGTAGCAAGTCAGGGTGCAAGCCCACTCGCAGTCTTTA
AAAAACCACATCTATGCTTAACATGCCAGAAGGTTCATTTGGTGCTCTGCCCATTTTGAA
GAGAGGAATACTCTTTCAAGGGAATTATTTCCATCTATAACCATTGGTTCCATGAGATAC
GGGACTCGCTCAGTTTTGGGTCGTTGTAACTTATTGACCACCGCCCTCCTTCCCCTTTTT
GTACATAAGACATCTCAGGCTGGCAAGGGCTCACTTTTGGACATGTAAGTATTCGAGCTC
ATATGGCCCAT
■■Homology search results ■■ -
sp_hit_id Q8FW50
Definition sp|Q8FW50|DPO4_BRUSU DNA polymerase IV OS=Brucella suis
Align length 32
Score (bit) 28.9
E-value 9.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917006|Adiantum capillus-veneris mRNA, clone:
YMU001_000094_F06.
(431 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8FW50|DPO4_BRUSU DNA polymerase IV OS=Brucella suis GN=dinB ... 29 9.3
sp|Q8YC76|DPO4_BRUME DNA polymerase IV OS=Brucella melitensis GN... 29 9.3

>sp|Q8FW50|DPO4_BRUSU DNA polymerase IV OS=Brucella suis GN=dinB
PE=3 SV=1
Length = 445

Score = 28.9 bits (63), Expect = 9.3
Identities = 16/32 (50%), Positives = 19/32 (59%)
Frame = -3

Query: 162 LHPDLLPETCDEAFPILGRIKRLQKTPPRVVL 67
L P + P + DEAF L +RL K PP VVL
Sbjct: 136 LTPLVEPISIDEAFLDLSGTERLHKAPPAVVL 167


>sp|Q8YC76|DPO4_BRUME DNA polymerase IV OS=Brucella melitensis
GN=dinB PE=3 SV=1
Length = 445

Score = 28.9 bits (63), Expect = 9.3
Identities = 16/32 (50%), Positives = 19/32 (59%)
Frame = -3

Query: 162 LHPDLLPETCDEAFPILGRIKRLQKTPPRVVL 67
L P + P + DEAF L +RL K PP VVL
Sbjct: 136 LTPLVEPISIDEAFLDLSGTERLHKAPPAVVL 167


tr_hit_id Q5LJZ6
Definition tr|Q5LJZ6|Q5LJZ6_DROME CG41075 OS=Drosophila melanogaster
Align length 95
Score (bit) 33.5
E-value 5.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917006|Adiantum capillus-veneris mRNA, clone:
YMU001_000094_F06.
(431 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5LJZ6|Q5LJZ6_DROME CG41075 OS=Drosophila melanogaster GN=CG4... 33 5.5
tr|Q5B2P6|Q5B2P6_EMENI Putative uncharacterized protein OS=Emeri... 33 9.3

>tr|Q5LJZ6|Q5LJZ6_DROME CG41075 OS=Drosophila melanogaster
GN=CG41075 PE=4 SV=2
Length = 378

Score = 33.5 bits (75), Expect = 5.5
Identities = 25/95 (26%), Positives = 41/95 (43%)
Frame = +2

Query: 110 PSMGKASSHVSGSKSGCKPTRSL*KTTSMLNMPEGSFGALPILKRGILFQGNYFHL*PLV 289
PS A + + G + +P+R + +T P G P+L RG + +
Sbjct: 47 PSCWTADAVLGGGATTQRPSREIPRTVDWAFPPAGG----PLLVRGAIREDEE------- 95

Query: 290 P*DTGLAQFWVVVTY*PPPSFPFLYIRHLRLARAH 394
P DT F V V+ PPP+ ++R + R+H
Sbjct: 96 PLDTRFGSFQVDVSQPPPPTSGHRHLRRTIIVRSH 130


>tr|Q5B2P6|Q5B2P6_EMENI Putative uncharacterized protein
OS=Emericella nidulans GN=AN5184.2 PE=4 SV=1
Length = 846

Score = 32.7 bits (73), Expect = 9.3
Identities = 14/35 (40%), Positives = 22/35 (62%)
Frame = -1

Query: 308 RVPYLMEPMVIDGNNSLERVFLSSKWAEHQMNLLA 204
+VPYL P++ DGN S+ R FL+ + ++ LA
Sbjct: 549 QVPYLFIPVIADGNGSMRRAFLNLLYPAIKLKALA 583