BP917029
Clone id YMU001_000095_A05
Library
Length 379
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000095_A05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TAATAATGTAGTTTCCTCTTATCATAATAGCTGTACAGTAAACTATTTAGCGTACAACAC
TTACGCGGATGGGGAACTCTTGCCACCGAGCTCCAAACCAACCTTTATGGCATACTTACT
GCTACTGTTGTTAGAAAAAAATCTGCAAGAATTCAGAAAAATCTCCCAGATGATAGTGTT
GGGCTTTAAGGGCATGCTCTCAATGAAATCCTCTGCCTCTTGCAGCAGAAAAGCCCGTCC
GAGCAAATCCACCATGCACGCACCGTGCTCCACAGATGGCATTATGTTGTACTTCCTGCC
CATAGACGCATAGATAGCACAGTCCTCATCTACCAGGCCTGCATGGCCACATGCACTGAG
AACACTAGTAAGCGTAATA
■■Homology search results ■■ -
sp_hit_id Q9FJY7
Definition sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana
Align length 71
Score (bit) 91.7
E-value 1.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917029|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_A05.
(379 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protei... 92 1e-18
sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protei... 84 2e-16
sp|Q9FIB2|PP373_ARATH Putative pentatricopeptide repeat-containi... 84 2e-16
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 83 5e-16
sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protei... 82 1e-15
sp|Q9FG85|PP415_ARATH Pentatricopeptide repeat-containing protei... 80 3e-15
sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protei... 79 5e-15
sp|Q9SV26|PP297_ARATH Pentatricopeptide repeat-containing protei... 79 5e-15
sp|Q9FMA1|PP433_ARATH Pentatricopeptide repeat-containing protei... 79 7e-15
sp|Q9LNU6|PPR53_ARATH Pentatricopeptide repeat-containing protei... 79 9e-15
sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 79 9e-15
sp|Q9M2Y7|PP274_ARATH Pentatricopeptide repeat-containing protei... 79 9e-15
sp|Q9LS72|PP261_ARATH Pentatricopeptide repeat-containing protei... 79 9e-15
sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protei... 78 2e-14
sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protei... 77 2e-14
sp|Q9CAY1|PP223_ARATH Putative pentatricopeptide repeat-containi... 77 2e-14
sp|Q683I9|PP295_ARATH Pentatricopeptide repeat-containing protei... 77 3e-14
sp|Q9LSB8|PP235_ARATH Putative pentatricopeptide repeat-containi... 77 3e-14
sp|Q9LXF2|PP385_ARATH Pentatricopeptide repeat-containing protei... 76 4e-14
sp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protei... 76 4e-14
sp|Q9LND4|PPR14_ARATH Pentatricopeptide repeat-containing protei... 76 6e-14
sp|Q9FND6|PP411_ARATH Pentatricopeptide repeat-containing protei... 76 6e-14
sp|Q9LXE8|PP386_ARATH Pentatricopeptide repeat-containing protei... 76 6e-14
sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protei... 76 6e-14
sp|Q9CA54|PP122_ARATH Pentatricopeptide repeat-containing protei... 76 6e-14
sp|Q9SS60|PP210_ARATH Pentatricopeptide repeat-containing protei... 75 8e-14
sp|Q9ZQ74|PP146_ARATH Pentatricopeptide repeat-containing protei... 75 8e-14
sp|Q9FGR2|PP436_ARATH Pentatricopeptide repeat-containing protei... 75 1e-13
sp|Q9LW32|PP258_ARATH Pentatricopeptide repeat-containing protei... 75 1e-13
sp|Q9MA85|PP215_ARATH Pentatricopeptide repeat-containing protei... 75 1e-13

>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein
At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1
Length = 620

Score = 91.7 bits (226), Expect = 1e-18
Identities = 42/71 (59%), Positives = 54/71 (76%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
IT T+VL+AC + GLV+E I+ SM R YN+ P++EH C+VDLLGRA LL EA+ FI+
Sbjct: 349 ITFTAVLTACSYTGLVEEGKLIFYSMERDYNLKPTIEHYGCIVDLLGRAGLLDEAKRFIQ 408

Query: 198 SMPLKPNTIIW 166
MPLKPN +IW
Sbjct: 409 EMPLKPNAVIW 419


>sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protein
At4g14820 OS=Arabidopsis thaliana GN=PCMP-H3 PE=2 SV=1
Length = 722

Score = 84.3 bits (207), Expect = 2e-16
Identities = 45/97 (46%), Positives = 56/97 (57%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+T VL C H+GLV+E I+ASM +YNI P +EH CMVDL GRA LL+EA + IE
Sbjct: 446 VTFVGVLYGCSHSGLVEEGKKIFASMTDEYNITPKLEHYGCMVDLFGRANLLREALEVIE 505

Query: 198 SMPLKPNTIIWEIXXXXXXXXXXXXXSKYAIKVGLEL 88
SMP+ N +IW K+A K LEL
Sbjct: 506 SMPVASNVVIWGSLMSACRIHGELELGKFAAKRILEL 542


>sp|Q9FIB2|PP373_ARATH Putative pentatricopeptide repeat-containing
protein At5g09950 OS=Arabidopsis thaliana GN=PCMP-H35
PE=3 SV=1
Length = 995

Score = 84.0 bits (206), Expect = 2e-16
Identities = 37/71 (52%), Positives = 48/71 (67%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+T VLSAC HAGL++E + SM Y + P +EH +CM D+LGRA L + EDFIE
Sbjct: 722 VTFVGVLSACSHAGLLEEGFKHFESMSDSYGLAPRIEHFSCMADVLGRAGELDKLEDFIE 781

Query: 198 SMPLKPNTIIW 166
MP+KPN +IW
Sbjct: 782 KMPMKPNVLIW 792


>sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protein
At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=2 SV=1
Length = 697

Score = 82.8 bits (203), Expect = 5e-16
Identities = 37/71 (52%), Positives = 51/71 (71%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
IT+ VLSACGHAG V+E ++SM R + + P +H CMVDLLGRA L+EA+ IE
Sbjct: 494 ITMIGVLSACGHAGFVEEGRHYFSSMTRDFGVAPLRDHYTCMVDLLGRAGFLEEAKSMIE 553

Query: 198 SMPLKPNTIIW 166
MP++P+++IW
Sbjct: 554 EMPMQPDSVIW 564



Score = 30.0 bits (66), Expect = 3.7
Identities = 14/65 (21%), Positives = 30/65 (46%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+TL SV+SAC + ++ + + + + VD+ + ++EA +
Sbjct: 254 VTLASVISACASLSAIKVGQEVHGRVVKNDKLRNDIILSNAFVDMYAKCSRIKEARFIFD 313

Query: 198 SMPLK 184
SMP++
Sbjct: 314 SMPIR 318


>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein
At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2
Length = 1064

Score = 81.6 bits (200), Expect = 1e-15
Identities = 35/71 (49%), Positives = 49/71 (69%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+TL VLSAC H GLVD+ A + SM +Y + P EH C+VD+L RA LL A++FI+
Sbjct: 794 VTLVGVLSACSHIGLVDKGIAYFESMNSEYGLSPKPEHYVCVVDMLTRAGLLSRAKEFIQ 853

Query: 198 SMPLKPNTIIW 166
MP+KP+ ++W
Sbjct: 854 EMPIKPDALVW 864


>sp|Q9FG85|PP415_ARATH Pentatricopeptide repeat-containing protein
At5g43790 OS=Arabidopsis thaliana GN=PCMP-E30 PE=2 SV=1
Length = 460

Score = 80.1 bits (196), Expect = 3e-15
Identities = 37/70 (52%), Positives = 47/70 (67%)
Frame = -2

Query: 375 TLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIES 196
T +SAC H+GLVDE I+ SM Y I P VEH C+VDLLGR+ L+EAE+ I+
Sbjct: 319 TFVVTISACSHSGLVDEGLQIFNSMKAVYGIEPKVEHYGCLVDLLGRSGRLEEAEECIKK 378

Query: 195 MPLKPNTIIW 166
MP+KPN +W
Sbjct: 379 MPVKPNATLW 388


>sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protein
At1g50270 OS=Arabidopsis thaliana GN=PCMP-E42 PE=2 SV=1
Length = 596

Score = 79.3 bits (194), Expect = 5e-15
Identities = 34/71 (47%), Positives = 49/71 (69%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+T +VLSAC H GLV+E ++ SM ++N+ P +H ACMVDL GR LL+EA+ IE
Sbjct: 408 VTFMAVLSACAHGGLVEEGRRLFLSMKGRFNMEPKADHYACMVDLFGRKGLLEEAKALIE 467

Query: 198 SMPLKPNTIIW 166
MP++P ++W
Sbjct: 468 RMPMEPTNVVW 478



Score = 32.0 bits (71), Expect = 0.97
Identities = 23/70 (32%), Positives = 34/70 (48%)
Frame = -2

Query: 375 TLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIES 196
TL+SVLSAC H G + ++ M K +I + G ++DL + L+EA E
Sbjct: 308 TLSSVLSACAHVGALHRGRRVHCYM-IKNSIEINTTAGTTLIDLYVKCGCLEEAILVFER 366

Query: 195 MPLKPNTIIW 166
+ K N W
Sbjct: 367 LHEK-NVYTW 375


>sp|Q9SV26|PP297_ARATH Pentatricopeptide repeat-containing protein
At4g01030, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H65 PE=2 SV=2
Length = 768

Score = 79.3 bits (194), Expect = 5e-15
Identities = 38/71 (53%), Positives = 50/71 (70%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
IT TSVLS C ++GLV E + M +Y I+P++EH +CMVDLLGR+ L EA DFI+
Sbjct: 498 ITFTSVLSVCKNSGLVQEGWKYFDLMRSRYGIIPTIEHCSCMVDLLGRSGYLDEAWDFIQ 557

Query: 198 SMPLKPNTIIW 166
+M LKP+ IW
Sbjct: 558 TMSLKPDATIW 568


>sp|Q9FMA1|PP433_ARATH Pentatricopeptide repeat-containing protein
At5g56310 OS=Arabidopsis thaliana GN=PCMP-E13 PE=2 SV=1
Length = 530

Score = 79.0 bits (193), Expect = 7e-15
Identities = 36/71 (50%), Positives = 48/71 (67%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+T ++LSAC H G VD ++ SM KY I P++EH CM+DLLGRA L+EA++ I+
Sbjct: 352 VTFIAILSACSHVGWVDLGKRLFNSMRSKYGIHPNIEHYGCMIDLLGRAGKLREADEVIK 411

Query: 198 SMPLKPNTIIW 166
SMP K N IW
Sbjct: 412 SMPFKANAAIW 422


>sp|Q9LNU6|PPR53_ARATH Pentatricopeptide repeat-containing protein
At1g20230 OS=Arabidopsis thaliana GN=PCMP-H21 PE=2 SV=2
Length = 760

Score = 78.6 bits (192), Expect = 9e-15
Identities = 36/71 (50%), Positives = 48/71 (67%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
I+ TS+LSACG GL DE + M +Y I P +EH +CMV+LLGRA LQEA D I+
Sbjct: 490 ISFTSLLSACGQVGLTDEGWKYFKMMSEEYGIKPRLEHYSCMVNLLGRAGKLQEAYDLIK 549

Query: 198 SMPLKPNTIIW 166
MP +P++ +W
Sbjct: 550 EMPFEPDSCVW 560


tr_hit_id A7PCR5
Definition tr|A7PCR5|A7PCR5_VITVI Chromosome chr17 scaffold_12, whole genome shotgun sequence OS=Vitis vinifera
Align length 71
Score (bit) 89.0
E-value 1.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917029|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_A05.
(379 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PCR5|A7PCR5_VITVI Chromosome chr17 scaffold_12, whole genom... 89 1e-16
tr|A7PNH6|A7PNH6_VITVI Chromosome chr1 scaffold_22, whole genome... 89 1e-16
tr|A5CBT0|A5CBT0_VITVI Putative uncharacterized protein OS=Vitis... 89 1e-16
tr|A7QBJ2|A7QBJ2_VITVI Chromosome chr13 scaffold_74, whole genom... 88 2e-16
tr|A2ZM04|A2ZM04_ORYSI Putative uncharacterized protein OS=Oryza... 86 7e-16
tr|Q2QN60|Q2QN60_ORYSJ Pentatricopeptide, putative, expressed OS... 86 1e-15
tr|Q0IMC8|Q0IMC8_ORYSJ Os12g0578000 protein OS=Oryza sativa subs... 86 1e-15
tr|A7QW88|A7QW88_VITVI Chromosome undetermined scaffold_200, who... 86 1e-15
tr|A7PN01|A7PN01_VITVI Chromosome chr14 scaffold_21, whole genom... 86 1e-15
tr|A5BYV5|A5BYV5_VITVI Putative uncharacterized protein OS=Vitis... 86 1e-15
tr|A3CIS7|A3CIS7_ORYSJ Putative uncharacterized protein OS=Oryza... 86 1e-15
tr|Q7XSV8|Q7XSV8_ORYSJ Os04g0110500 protein OS=Oryza sativa subs... 85 2e-15
tr|Q25AD3|Q25AD3_ORYSA H0201G08.10 protein OS=Oryza sativa GN=H0... 85 2e-15
tr|A7QMS3|A7QMS3_VITVI Chromosome undetermined scaffold_127, who... 85 2e-15
tr|A5B4W3|A5B4W3_VITVI Putative uncharacterized protein OS=Vitis... 85 2e-15
tr|A2XPN5|A2XPN5_ORYSI Putative uncharacterized protein OS=Oryza... 85 2e-15
tr|A7Q9C2|A7Q9C2_VITVI Chromosome chr19 scaffold_66, whole genom... 84 3e-15
tr|A7Q306|A7Q306_VITVI Chromosome chr12 scaffold_47, whole genom... 84 3e-15
tr|A5APN9|A5APN9_VITVI Putative uncharacterized protein OS=Vitis... 84 3e-15
tr|A7Q1A2|A7Q1A2_VITVI Chromosome chr10 scaffold_43, whole genom... 84 3e-15
tr|B7U9V0|B7U9V0_CARAS AT5G09950-like protein OS=Cardaminopsis a... 84 5e-15
tr|A7QD49|A7QD49_VITVI Chromosome undetermined scaffold_80, whol... 84 5e-15
tr|A7Q044|A7Q044_VITVI Chromosome chr8 scaffold_41, whole genome... 84 5e-15
tr|A5AE49|A5AE49_VITVI Putative uncharacterized protein OS=Vitis... 84 5e-15
tr|B6SSC4|B6SSC4_MAIZE Pentatricopeptide repeat protein PPR868-1... 83 6e-15
tr|Q10MC4|Q10MC4_ORYSJ Os03g0314400 protein OS=Oryza sativa subs... 83 8e-15
tr|A7P6R9|A7P6R9_VITVI Chromosome chr9 scaffold_7, whole genome ... 83 8e-15
tr|A5B4B4|A5B4B4_VITVI Putative uncharacterized protein OS=Vitis... 83 8e-15
tr|A2XFZ4|A2XFZ4_ORYSI Putative uncharacterized protein OS=Oryza... 83 8e-15
tr|Q84MQ1|Q84MQ1_ORYSJ Putative uncharacterized protein OSJNBb00... 82 1e-14

>tr|A7PCR5|A7PCR5_VITVI Chromosome chr17 scaffold_12, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015978001
PE=4 SV=1
Length = 698

Score = 89.0 bits (219), Expect = 1e-16
Identities = 39/71 (54%), Positives = 52/71 (73%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+T VLSAC HAGLVDE ++ SM R + I P +EH CMVD+LGRA L++EA FI+
Sbjct: 428 VTFIGVLSACSHAGLVDEGRDLFVSMSRDFGIEPRIEHYGCMVDILGRAGLIEEAFQFIK 487

Query: 198 SMPLKPNTIIW 166
+MP++PN +IW
Sbjct: 488 NMPIQPNAVIW 498


>tr|A7PNH6|A7PNH6_VITVI Chromosome chr1 scaffold_22, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021258001
PE=4 SV=1
Length = 563

Score = 88.6 bits (218), Expect = 1e-16
Identities = 41/71 (57%), Positives = 52/71 (73%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+T T +L+AC HAGLV E ++ SM R + PS+EH CMVDLLGRA LL+EAE+ IE
Sbjct: 293 MTFTGILTACSHAGLVHEAKLLFESMERIHGFKPSIEHYGCMVDLLGRAGLLKEAEELIE 352

Query: 198 SMPLKPNTIIW 166
+MP+KPN IW
Sbjct: 353 NMPVKPNAAIW 363


>tr|A5CBT0|A5CBT0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_030261 PE=4 SV=1
Length = 622

Score = 88.6 bits (218), Expect = 1e-16
Identities = 41/71 (57%), Positives = 52/71 (73%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+T T +L+AC HAGLV E ++ SM R + PS+EH CMVDLLGRA LL+EAE+ IE
Sbjct: 352 MTFTGILTACSHAGLVHEAKLLFESMERIHGFKPSIEHYGCMVDLLGRAGLLKEAEELIE 411

Query: 198 SMPLKPNTIIW 166
+MP+KPN IW
Sbjct: 412 NMPVKPNAAIW 422


>tr|A7QBJ2|A7QBJ2_VITVI Chromosome chr13 scaffold_74, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034995001
PE=4 SV=1
Length = 926

Score = 88.2 bits (217), Expect = 2e-16
Identities = 43/72 (59%), Positives = 52/72 (72%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
++ VL AC HAGLVDE A + SM +KY IMP V H CMVDLLGRA L EAE IE
Sbjct: 656 MSFLGVLCACSHAGLVDEGWAHFNSMTQKYGIMPLVYHYTCMVDLLGRAGYLSEAEALIE 715

Query: 198 SMPLKPNTIIWE 163
+MP+KP+++IWE
Sbjct: 716 NMPVKPDSVIWE 727


>tr|A2ZM04|A2ZM04_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_38867 PE=4 SV=1
Length = 914

Score = 86.3 bits (212), Expect = 7e-16
Identities = 38/71 (53%), Positives = 51/71 (71%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+T+ +VLSAC H G VDE +++M R Y IMP +EH CM+DLLGR L++EA D I+
Sbjct: 725 VTMINVLSACTHMGFVDEGRRYFSNMERDYGIMPQIEHYGCMIDLLGRGGLIKEAVDLIK 784

Query: 198 SMPLKPNTIIW 166
SMP +PN +IW
Sbjct: 785 SMPWEPNEVIW 795


>tr|Q2QN60|Q2QN60_ORYSJ Pentatricopeptide, putative, expressed
OS=Oryza sativa subsp. japonica GN=LOC_Os12g38880 PE=4
SV=2
Length = 491

Score = 85.5 bits (210), Expect = 1e-15
Identities = 38/71 (53%), Positives = 51/71 (71%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+T+ +VLSAC H G VDE +++M R Y IMP +EH CM+DLLGR L++EA D I+
Sbjct: 302 VTMINVLSACTHMGFVDEGRRHFSNMERDYGIMPQIEHYGCMIDLLGRGGLIKEAVDLIK 361

Query: 198 SMPLKPNTIIW 166
SMP +PN +IW
Sbjct: 362 SMPWEPNEVIW 372


>tr|Q0IMC8|Q0IMC8_ORYSJ Os12g0578000 protein OS=Oryza sativa subsp.
japonica GN=Os12g0578000 PE=4 SV=1
Length = 611

Score = 85.5 bits (210), Expect = 1e-15
Identities = 38/71 (53%), Positives = 51/71 (71%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+T+ +VLSAC H G VDE +++M R Y IMP +EH CM+DLLGR L++EA D I+
Sbjct: 422 VTMINVLSACTHMGFVDEGRRHFSNMERDYGIMPQIEHYGCMIDLLGRGGLIKEAVDLIK 481

Query: 198 SMPLKPNTIIW 166
SMP +PN +IW
Sbjct: 482 SMPWEPNEVIW 492


>tr|A7QW88|A7QW88_VITVI Chromosome undetermined scaffold_200, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00007743001 PE=4 SV=1
Length = 486

Score = 85.5 bits (210), Expect = 1e-15
Identities = 39/71 (54%), Positives = 54/71 (76%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+TL SVLSAC HAGLV E +++ M + + I P ++H CMVDLLGRA LL+EA++ IE
Sbjct: 307 VTLLSVLSACSHAGLVVEGRSLFQKMVQCHGIKPKIQHYGCMVDLLGRAGLLREAKELIE 366

Query: 198 SMPLKPNTIIW 166
MP+KP+++IW
Sbjct: 367 HMPIKPDSVIW 377


>tr|A7PN01|A7PN01_VITVI Chromosome chr14 scaffold_21, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021011001
PE=4 SV=1
Length = 624

Score = 85.5 bits (210), Expect = 1e-15
Identities = 38/70 (54%), Positives = 50/70 (71%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+T TSVLSAC H+GLVD+ C + ++ Y I P VEH ACMVDLLGRA L+EAE +
Sbjct: 353 VTFTSVLSACSHSGLVDQGCFYFGNLESVYGITPKVEHYACMVDLLGRAGRLEEAEILVR 412

Query: 198 SMPLKPNTII 169
MP++PN ++
Sbjct: 413 EMPIRPNEVV 422


>tr|A5BYV5|A5BYV5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_025676 PE=4 SV=1
Length = 768

Score = 85.5 bits (210), Expect = 1e-15
Identities = 39/71 (54%), Positives = 54/71 (76%)
Frame = -2

Query: 378 ITLTSVLSACGHAGLVDEDCAIYASMGRKYNIMPSVEHGACMVDLLGRAFLLQEAEDFIE 199
+TL SVLSAC HAGLV E +++ M + + I P ++H CMVDLLGRA LL+EA++ IE
Sbjct: 589 VTLLSVLSACSHAGLVVEGRSLFQKMVQCHGIKPKIQHYGCMVDLLGRAGLLREAKELIE 648

Query: 198 SMPLKPNTIIW 166
MP+KP+++IW
Sbjct: 649 HMPIKPDSVIW 659