BP917052
Clone id YMU001_000095_C11
Library
Length 487
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000095_C11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAGAAACCATCTTGCCTTTATGACTTTCATATTACTTCATTTTTTGACATTCAGTTCAAC
TGGTCTCCTCTACCATGCACTAGACTCACTAACAGGTGCATGACATCCAGCAAAGGTTTT
CCTGTTAGCCTGCTCTAAAGCTTTGAACCTCAAAAAATAGTTCTACAGAGAACTTTGAAG
TAGCCAATCCCGACAAGAGTTCCTAGAGAGTAAGCTCGCCATGGGATGTGGAACAGGAGC
AGCCCCCCTCTGCTCATTGATATTGAGTACAAGGCTATCAAGCAGTGCATCCAATGTGTT
TTCACTGATGCTTAGCCCAAAATGAAGAACCAAGTGCAACCGCCTTGCTTCTTCTGACCT
CTCTGGGTTGTCCTTCATGCAAAGACCCTGCTGATTGCTCCCATGCACAAGAAGTATGAC
ACCCTCTTCTACCTTCTCCAAGCACATATACACCAGAGCATTTGCAATCTCATCTTGATG
TAATTTC
■■Homology search results ■■ -
sp_hit_id Q9LSV3
Definition sp|Q9LSV3|WAKLS_ARATH Putative wall-associated receptor kinase-like 16 OS=Arabidopsis thaliana
Align length 59
Score (bit) 38.1
E-value 0.021
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917052|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_C11.
(487 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LSV3|WAKLS_ARATH Putative wall-associated receptor kinase-l... 38 0.021
sp|Q9LMN6|WAK4_ARATH Wall-associated receptor kinase 4 OS=Arabid... 37 0.062
sp|Q9TLS6|APCE_CYACA Phycobilisome linker polypeptide OS=Cyanidi... 34 0.31
sp|P83964|ANF_ACITR Atrial natriuretic factor OS=Acipenser trans... 33 0.52
sp|Q39191|WAK1_ARATH Wall-associated receptor kinase 1 OS=Arabid... 33 0.53
sp|Q9LMN7|WAK5_ARATH Wall-associated receptor kinase 5 OS=Arabid... 33 0.90
sp|Q9LMN8|WAK3_ARATH Wall-associated receptor kinase 3 OS=Arabid... 32 1.5
sp|Q5UPY4|END4_MIMIV Putative endonuclease 4 OS=Acanthamoeba pol... 32 2.0
sp|Q3K5Q9|PQQB_PSEPF Coenzyme PQQ synthesis protein B OS=Pseudom... 31 3.4
sp|Q02907|APCE_SYNY4 Phycobilisome 100.5 kDa core-membrane linke... 30 4.5
sp|Q8C4N4|PQLC2_MOUSE PQ-loop repeat-containing protein 2 OS=Mus... 30 5.7
sp|P80559|APCE_ANASP Phycobilisome linker polypeptide OS=Anabaen... 30 5.8
sp|O75578|ITA10_HUMAN Integrin alpha-10 OS=Homo sapiens GN=ITGA1... 30 7.6
sp|Q0K2D1|PQQB_RALEH Coenzyme PQQ synthesis protein B OS=Ralston... 29 9.9
sp|Q4ZMC4|PQQB_PSEU2 Coenzyme PQQ synthesis protein B OS=Pseudom... 29 9.9
sp|P35911|APCE_GALSU Phycobilisome linker polypeptide OS=Galdier... 29 9.9

>sp|Q9LSV3|WAKLS_ARATH Putative wall-associated receptor kinase-like
16 OS=Arabidopsis thaliana GN=WAKL16 PE=3 SV=1
Length = 433

Score = 38.1 bits (87), Expect = 0.021
Identities = 24/59 (40%), Positives = 33/59 (55%)
Frame = -2

Query: 423 GVILLVHGSNQQGLCMKDNPERSEEARRLHLVLHFGLSISENTLDALLDSLVLNINEQR 247
GV+L+ S Q+ LC + PE S+ HLV +F L+ EN L ++D VLN QR
Sbjct: 296 GVVLMELISGQKALCF-ERPETSK-----HLVSYFVLATKENRLHEIIDDQVLNEENQR 348


>sp|Q9LMN6|WAK4_ARATH Wall-associated receptor kinase 4
OS=Arabidopsis thaliana GN=WAK4 PE=2 SV=1
Length = 738

Score = 36.6 bits (83), Expect = 0.062
Identities = 21/59 (35%), Positives = 33/59 (55%)
Frame = -2

Query: 423 GVILLVHGSNQQGLCMKDNPERSEEARRLHLVLHFGLSISENTLDALLDSLVLNINEQR 247
GV+L+ S Q+ LC + P+ S+ H+V +F + EN L ++D V+N N QR
Sbjct: 598 GVVLMELLSGQKALCF-ERPQTSK-----HIVSYFASATKENRLHEIIDGQVMNENNQR 650


>sp|Q9TLS6|APCE_CYACA Phycobilisome linker polypeptide OS=Cyanidium
caldarium GN=apcE PE=3 SV=1
Length = 870

Score = 34.3 bits (77), Expect = 0.31
Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
Frame = -2

Query: 309 ISENTLDALLDSLVLNIN--EQRGAAPVPHPMASLLSRNSCRDWLLQSSL*NYFLRFKAL 136
+S N LDAL+DS++ N E G VP+ CR+W Q +L Y F+ +
Sbjct: 362 LSSNGLDALIDSIINNSEYAEYFGEETVPYIRGYGQEAQECRNWGSQFALFKYSAPFRTI 421

Query: 135 EQ 130
Q
Sbjct: 422 PQ 423


>sp|P83964|ANF_ACITR Atrial natriuretic factor OS=Acipenser
transmontanus GN=nppa PE=2 SV=1
Length = 142

Score = 33.5 bits (75), Expect = 0.52
Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 2/45 (4%)
Frame = +3

Query: 156 NSSTENFEVANPDKSS*RVSSPWDVEQEQ--PPSAH*Y*VQGYQA 284
N + +++++ANP+ + SPWD E+E+ P S + +GYQ+
Sbjct: 55 NDNQQDYDIANPEAEGPQAGSPWDRERERQWPASDYKKPQEGYQS 99


>sp|Q39191|WAK1_ARATH Wall-associated receptor kinase 1
OS=Arabidopsis thaliana GN=WAK1 PE=1 SV=2
Length = 735

Score = 33.5 bits (75), Expect = 0.53
Identities = 20/54 (37%), Positives = 30/54 (55%)
Frame = -2

Query: 423 GVILLVHGSNQQGLCMKDNPERSEEARRLHLVLHFGLSISENTLDALLDSLVLN 262
GV+L+ S Q+ LC K P+ S+ HLV +F + EN LD ++ V+N
Sbjct: 597 GVVLMELLSGQKALCFK-RPQSSK-----HLVSYFATATKENRLDEIIGGEVMN 644


>sp|Q9LMN7|WAK5_ARATH Wall-associated receptor kinase 5
OS=Arabidopsis thaliana GN=WAK5 PE=2 SV=1
Length = 733

Score = 32.7 bits (73), Expect = 0.90
Identities = 20/59 (33%), Positives = 33/59 (55%)
Frame = -2

Query: 423 GVILLVHGSNQQGLCMKDNPERSEEARRLHLVLHFGLSISENTLDALLDSLVLNINEQR 247
GV+L+ S ++ LC + P+ S+ HLV +F ++ EN L ++D V+N QR
Sbjct: 596 GVVLMELLSGEKALCF-ERPQSSK-----HLVSYFVSAMKENRLHEIIDGQVMNEYNQR 648


>sp|Q9LMN8|WAK3_ARATH Wall-associated receptor kinase 3
OS=Arabidopsis thaliana GN=WAK3 PE=2 SV=2
Length = 741

Score = 32.0 bits (71), Expect = 1.5
Identities = 20/54 (37%), Positives = 30/54 (55%)
Frame = -2

Query: 423 GVILLVHGSNQQGLCMKDNPERSEEARRLHLVLHFGLSISENTLDALLDSLVLN 262
GV+L+ S Q+ LC + P+ S+ HLV +F + EN L ++D VLN
Sbjct: 603 GVVLMELLSGQKALCF-ERPQASK-----HLVSYFVSATEENRLHEIIDDQVLN 650


>sp|Q5UPY4|END4_MIMIV Putative endonuclease 4 OS=Acanthamoeba
polyphaga mimivirus GN=MIMI_R296 PE=3 SV=1
Length = 312

Score = 31.6 bits (70), Expect = 2.0
Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 18/84 (21%)
Frame = -2

Query: 432 VEEGVILLVHGSNQQGLCMKDNPERSEEA----------------RRLHLVLHFGLSISE 301
++ +I++VHGS LC ++ E + R L +++H G +ISE
Sbjct: 75 IKHDLIMVVHGSYTINLCHPPGSKKFETSIKSLVKDLNATNLIGDRCLGVIIHMGKNISE 134

Query: 300 N--TLDALLDSLVLNINEQRGAAP 235
N T+D +D+ V I P
Sbjct: 135 NKLTVDQAIDNYVTGIKTALSQTP 158


>sp|Q3K5Q9|PQQB_PSEPF Coenzyme PQQ synthesis protein B
OS=Pseudomonas fluorescens (strain Pf0-1) GN=pqqB PE=3
SV=1
Length = 303

Score = 30.8 bits (68), Expect = 3.4
Identities = 17/45 (37%), Positives = 28/45 (62%)
Frame = -2

Query: 441 LEKVEEGVILLVHGSNQQGLCMKDNPERSEEARRLHLVLHFGLSI 307
LE++ E +L+H +N + +D+PER+E RR V + G+SI
Sbjct: 257 LEQLPEQRKVLIHINNTNPILDEDSPERAELVRRNVEVAYDGMSI 301


>sp|Q02907|APCE_SYNY4 Phycobilisome 100.5 kDa core-membrane linker
polypeptide OS=Synechocystis sp. (strain PCC 6714) PE=3
SV=1
Length = 896

Score = 30.4 bits (67), Expect = 4.5
Identities = 25/100 (25%), Positives = 43/100 (43%), Gaps = 2/100 (2%)
Frame = -2

Query: 366 PERSEEARRLHLVLHFGLSISENTLDALLDSLV--LNINEQRGAAPVPHPMASLLSRNSC 193
P EE ++ + +S L AL+D+LV ++ G VP+ + C
Sbjct: 355 PSSREEVQKYFAI------VSNGGLPALVDALVDSQEYSDYFGEETVPYLRGLGVEAQEC 408

Query: 192 RDWLLQSSL*NYFLRFKALEQANRKTFAGCHAPVSESSAW 73
R+W +Q L +Y F+ + Q TFA P+ + +
Sbjct: 409 RNWGMQQDLFSYSAPFRKVPQF-ITTFAQYDRPLPDQHVY 447


tr_hit_id B7KKS7
Definition tr|B7KKS7|B7KKS7_9CHRO Phycobilisome linker polypeptide OS=Cyanothece sp. PCC 7424
Align length 81
Score (bit) 35.0
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917052|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_C11.
(487 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B7KKS7|B7KKS7_9CHRO Phycobilisome linker polypeptide OS=Cyano... 35 1.9
tr|B5I590|B5I590_9ACTO Putative uncharacterized protein OS=Strep... 34 4.1

>tr|B7KKS7|B7KKS7_9CHRO Phycobilisome linker polypeptide
OS=Cyanothece sp. PCC 7424 GN=PCC7424_2632 PE=4 SV=1
Length = 898

Score = 35.0 bits (79), Expect = 1.9
Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
Frame = -2

Query: 309 ISENTLDALLDSLV--LNINEQRGAAPVPHPMASLLSRNSCRDWLLQSSL*NYFLRFKAL 136
+S+ L AL+D+LV ++ G VP+ L CR+W +Q L NY F+ +
Sbjct: 374 VSQGGLSALVDALVDSQEYSDYFGEETVPYLRGLGLEAQECRNWGMQQDLFNYSAPFRKV 433

Query: 135 EQANRKTFAGCHAPVSESSAW 73
Q TFA + P+ + +
Sbjct: 434 PQF-ITTFAQYNRPLPDQHVY 453


>tr|B5I590|B5I590_9ACTO Putative uncharacterized protein
OS=Streptomyces sviceus ATCC 29083 GN=SSEG_06824 PE=4
SV=1
Length = 214

Score = 33.9 bits (76), Expect = 4.1
Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 2/94 (2%)
Frame = -3

Query: 458 LWCICAWRR*KRVSYFLCMGAISRVFA*R--TTQRGQKKQGGCTWFFILG*ASVKTHWMH 285
+WC + R +R + F+ +GA++ F T+ + + G T +++G W
Sbjct: 81 VWCAASRRAGRRATAFVAVGALTAAFLAHGLATRPVRAEIRGHTMAYVIG-----LPWAE 135

Query: 284 CLIALYSISMSRGGLLLFHIPWRAYSLGTLVGIG 183
L+A Y I+ G LLF R +LG L G G
Sbjct: 136 LLVAGYLIATV--GALLFSGDRRLTALGILAGAG 167