BP917055
Clone id YMU001_000095_D02
Library
Length 556
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000095_D02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGCCTAGCTTGATCATGAGCTTTTCTTTGTCATTGCAGGAAGGTCTCTGCGAAACTATCC
CACTCTAGGGAGTTGCAGGAAGATATTAATCCAATTCTCTATTTCAAGGGCTTCATAGTA
CTACCGCATTTGCACTGTAGTCAACATCAGGCCATTTTTCTTTAGCAAGAAACTGGGAAG
CATACCGTGGCTTTTCAAAAACCTCAATACTCTGCTCAGCTCTTTTGCAATCTTCCACTG
TGAAACGTATAGCTAGGAGGCATAAGAACTATCCATGTGAAGCTACCCAGTTCAGCCACT
TCATGAAAGCAAAGTTTGCCAACTGTTCTGGTATTTCATCCTTTTCCAAGCCCATGTTGA
AATTGTCAGTGGAGAGATACCAACGGCCATTATTATCGCCGAGACCTCGATCACTGGTAG
CAATACCACTTTCCAAACTGTTAGATTCTTCATCACTACTTGCATGTGCAGTTCTCCTCC
TCTTCTTCCTCCTCCTCTTTCTCATCTTCTCAACTTGCATCCTTCCTCTCCCAGGAAGCT
TGACGGAACTGAATTG
■■Homology search results ■■ -
sp_hit_id Q16281
Definition sp|Q16281|CNGA3_HUMAN Cyclic nucleotide-gated cation channel alpha-3 OS=Homo sapiens
Align length 26
Score (bit) 31.2
E-value 3.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917055|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_D02.
(556 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q16281|CNGA3_HUMAN Cyclic nucleotide-gated cation channel alp... 31 3.6

>sp|Q16281|CNGA3_HUMAN Cyclic nucleotide-gated cation channel
alpha-3 OS=Homo sapiens GN=CNGA3 PE=1 SV=2
Length = 694

Score = 31.2 bits (69), Expect = 3.6
Identities = 14/26 (53%), Positives = 19/26 (73%)
Frame = -1

Query: 469 AHASSDEESNSLESGIATSDRGLGDN 392
AH+SS+E S+ L+ GIA RGL D+
Sbjct: 35 AHSSSEETSSVLQPGIAMETRGLADS 60


tr_hit_id A7R7S5
Definition tr|A7R7S5|A7R7S5_VITVI Chromosome undetermined scaffold_1994, whole genome shotgun sequence OS=Vitis vinifera
Align length 41
Score (bit) 43.5
E-value 0.008
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917055|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_D02.
(556 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7R7S5|A7R7S5_VITVI Chromosome undetermined scaffold_1994, wh... 44 0.008
tr|A7R454|A7R454_VITVI Chromosome undetermined scaffold_619, who... 44 0.008
tr|B6U7C4|B6U7C4_MAIZE Putative uncharacterized protein OS=Zea m... 42 0.022
tr|Q8LJ29|Q8LJ29_ORYSJ Putative uncharacterized protein P0674H09... 40 0.11
tr|A9SZF1|A9SZF1_PHYPA Predicted protein OS=Physcomitrella paten... 35 2.7
tr|Q1V067|Q1V067_9RICK Spermidine/putrescine transport system pe... 33 7.9

>tr|A7R7S5|A7R7S5_VITVI Chromosome undetermined scaffold_1994, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00010205001 PE=4 SV=1
Length = 509

Score = 43.5 bits (101), Expect = 0.008
Identities = 15/41 (36%), Positives = 24/41 (58%)
Frame = -1

Query: 406 GLGDNNGRWYLSTDNFNMGLEKDEIPEQLANFAFMKWLNWV 284
GLG + G W LSTD ++ ++PE L+ F W++W+
Sbjct: 461 GLGSHTGSWLLSTDGYSTSWSSVDLPEHLSKHCFSTWMSWI 501


>tr|A7R454|A7R454_VITVI Chromosome undetermined scaffold_619, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00004172001 PE=4 SV=1
Length = 508

Score = 43.5 bits (101), Expect = 0.008
Identities = 15/41 (36%), Positives = 24/41 (58%)
Frame = -1

Query: 406 GLGDNNGRWYLSTDNFNMGLEKDEIPEQLANFAFMKWLNWV 284
GLG + G W LSTD ++ ++PE L+ F W++W+
Sbjct: 460 GLGSHTGSWLLSTDGYSTSWSSVDLPEHLSKHCFSTWMSWI 500


>tr|B6U7C4|B6U7C4_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 285

Score = 42.0 bits (97), Expect = 0.022
Identities = 18/59 (30%), Positives = 29/59 (49%)
Frame = -1

Query: 463 ASSDEESNSLESGIATSDRGLGDNNGRWYLSTDNFNMGLEKDEIPEQLANFAFMKWLNW 287
+ D+ LE G + G+ G W LSTD F+ + +IP+ L+ F+ W+ W
Sbjct: 223 SDEDKFDELLELGSSDGKNGVESQRGSWRLSTDGFSASWDISDIPDHLSTCYFIIWVKW 281


>tr|Q8LJ29|Q8LJ29_ORYSJ Putative uncharacterized protein P0674H09.17
(Os01g0897100 protein) OS=Oryza sativa subsp. japonica
GN=P0674H09.17 PE=4 SV=1
Length = 509

Score = 39.7 bits (91), Expect = 0.11
Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
Frame = -1

Query: 457 SDEESNSLESGIATSDR-GLGDNNGRWYLSTDNFNMGLEKDEIPEQLANFAFMKWLNW 287
SDE+ + TS+R G+ ++G WYLSTD F+ + +IP+ L++ WL +
Sbjct: 448 SDEDDLDQLLELGTSNRRGIESHHGCWYLSTDGFSASWDIADIPDHLSSHYLKTWLKF 505


>tr|A9SZF1|A9SZF1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_86072 PE=4 SV=1
Length = 510

Score = 35.0 bits (79), Expect = 2.7
Identities = 17/63 (26%), Positives = 32/63 (50%)
Frame = -1

Query: 469 AHASSDEESNSLESGIATSDRGLGDNNGRWYLSTDNFNMGLEKDEIPEQLANFAFMKWLN 290
A S DE S+ +E ++ + W +S DN+++ + ++ E L FA WL+
Sbjct: 449 ADDSDDESSDDIE---LSNPEIFSKDEQDWRVSIDNYSLTWTRADLAEYLTGFAVQGWLD 505

Query: 289 WVA 281
W++
Sbjct: 506 WLS 508


>tr|Q1V067|Q1V067_9RICK Spermidine/putrescine transport system
permease protein potb OS=Candidatus Pelagibacter ubique
HTCC1002 GN=PU1002_06551 PE=3 SV=1
Length = 415

Score = 33.5 bits (75), Expect = 7.9
Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
Frame = -1

Query: 226 KRAEQSIEVFEKPRYASQFLAKEK-WPDVDY 137
K+ ++I+ FEK Y QF+A K W DVDY
Sbjct: 121 KKTNRTIKKFEKANYKEQFMATHKIWKDVDY 151