BP917056
Clone id YMU001_000095_D03
Library
Length 479
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000095_D03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCAGAGTGTGGGTGTTTGAGGTTTTCTATGGAGTGTCTATAAGATCTGATTGTGCAGGGT
TTGTGCTGTTTCAAGTCTTCTTTGCCTATCCATGGGATGGCTAGCTGATCTCACGGTACA
CATTTTGTCAAAAGTAGAAACTTGATAATCGGAGGTTGTTCTCGTATATATCTTGGGGTG
CGCAGGTGTTAGAGCCATCTGACATGTAATCGCTGAGTATGCTCCCTTCTCGTGTCTTTT
AACAGGTCCGTCTTCAGCTTGAGGCCCTTCTTGCAGAGAAAGCAAGGTTGGTACAAGAAA
ATGCTGCGTATGCAAGGGAAAATCAGTTTCTACATGAAGTTGTACAATATCATCAGCTAA
GGTTGCGGAGTATAGGGTTTCCAGACGAGAGTCTGATGTTGGATGACGAAGGGCCTTTGG
ATGCATCAGCTGTAGACATGGACTTCCTGCCTCTCTATCCGGAGGAGAAAGATATAATT
■■Homology search results ■■ -
sp_hit_id Q61545
Definition sp|Q61545|EWS_MOUSE RNA-binding protein EWS OS=Mus musculus
Align length 77
Score (bit) 34.7
E-value 0.23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917056|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_D03.
(479 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q61545|EWS_MOUSE RNA-binding protein EWS OS=Mus musculus GN=E... 35 0.23
sp|Q5WUB9|EX7S_LEGPL Exodeoxyribonuclease 7 small subunit OS=Leg... 30 4.3
sp|Q5ZT36|EX7S_LEGPH Exodeoxyribonuclease 7 small subunit OS=Leg... 30 4.3
sp|A5IEC9|EX7S_LEGPC Exodeoxyribonuclease 7 small subunit OS=Leg... 30 5.6
sp|Q5X2W0|EX7S_LEGPA Exodeoxyribonuclease 7 small subunit OS=Leg... 30 5.6
sp|P52962|MOES_LYTVA Moesin OS=Lytechinus variegatus PE=3 SV=1 30 7.4
sp|Q02099|RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces ... 29 9.6
sp|Q8QGX4|PRKDC_CHICK DNA-dependent protein kinase catalytic sub... 29 9.6
sp|A6UUW0|PCNA_META3 DNA polymerase sliding clamp OS=Methanococc... 29 9.6
sp|Q01844|EWS_HUMAN RNA-binding protein EWS OS=Homo sapiens GN=E... 29 9.6

>sp|Q61545|EWS_MOUSE RNA-binding protein EWS OS=Mus musculus
GN=Ewsr1 PE=1 SV=1
Length = 655

Score = 34.7 bits (78), Expect = 0.23
Identities = 21/77 (27%), Positives = 33/77 (42%)
Frame = -3

Query: 291 PTLLSLQEGPQAEDGPVKRHEKGAYSAITCQMALTPAHPKIYTRTTSDYQVSTFDKMCTV 112
PT S PQA PV+ + GAY + T + T A + + T+ + T
Sbjct: 74 PTGYSTPTAPQAYSQPVQGYGTGAYDSTTATVTTTQASYAAQSAYGTQPAYPTYGQQPTA 133

Query: 111 RSASHPMDRQRRLETAQ 61
+ + P D + ET+Q
Sbjct: 134 TAPTRPQDGNKPAETSQ 150


>sp|Q5WUB9|EX7S_LEGPL Exodeoxyribonuclease 7 small subunit
OS=Legionella pneumophila (strain Lens) GN=xseB PE=3
SV=1
Length = 76

Score = 30.4 bits (67), Expect = 4.3
Identities = 17/46 (36%), Positives = 25/46 (54%)
Frame = -3

Query: 276 LQEGPQAEDGPVKRHEKGAYSAITCQMALTPAHPKIYTRTTSDYQV 139
L++G + + +K+ EKG A CQ AL A KI T T +D +
Sbjct: 21 LEKGELSLEESLKQFEKGISLARRCQNALNQAEQKIETLTGTDSNI 66


>sp|Q5ZT36|EX7S_LEGPH Exodeoxyribonuclease 7 small subunit
OS=Legionella pneumophila subsp. pneumophila (strain
Philadelphia 1 / ATCC 33152 / DSM 7513) GN=xseB PE=3
SV=1
Length = 76

Score = 30.4 bits (67), Expect = 4.3
Identities = 17/46 (36%), Positives = 25/46 (54%)
Frame = -3

Query: 276 LQEGPQAEDGPVKRHEKGAYSAITCQMALTPAHPKIYTRTTSDYQV 139
L++G + + +K+ EKG A CQ AL A KI T T +D +
Sbjct: 21 LEKGELSLEESLKQFEKGISLARRCQNALNQAEQKIETLTGTDSNI 66


>sp|A5IEC9|EX7S_LEGPC Exodeoxyribonuclease 7 small subunit
OS=Legionella pneumophila (strain Corby) GN=xseB PE=3
SV=1
Length = 76

Score = 30.0 bits (66), Expect = 5.6
Identities = 17/46 (36%), Positives = 24/46 (52%)
Frame = -3

Query: 276 LQEGPQAEDGPVKRHEKGAYSAITCQMALTPAHPKIYTRTTSDYQV 139
L++G + +K+ EKG A CQ AL A KI T T +D +
Sbjct: 21 LEKGELTLEESLKQFEKGISLARRCQNALNQAEQKIETLTGTDSNI 66


>sp|Q5X2W0|EX7S_LEGPA Exodeoxyribonuclease 7 small subunit
OS=Legionella pneumophila (strain Paris) GN=xseB PE=3
SV=1
Length = 76

Score = 30.0 bits (66), Expect = 5.6
Identities = 17/46 (36%), Positives = 24/46 (52%)
Frame = -3

Query: 276 LQEGPQAEDGPVKRHEKGAYSAITCQMALTPAHPKIYTRTTSDYQV 139
L++G + +K+ EKG A CQ AL A KI T T +D +
Sbjct: 21 LEKGELTLEESLKQFEKGISLARRCQNALNQAEQKIETLTGTDSNI 66


>sp|P52962|MOES_LYTVA Moesin OS=Lytechinus variegatus PE=3 SV=1
Length = 572

Score = 29.6 bits (65), Expect = 7.4
Identities = 21/77 (27%), Positives = 33/77 (42%)
Frame = +3

Query: 243 QVRLQLEALLAEKARLVQENAAYARENQFLHEVVQYHQLRLRSIGFPDESLMLDDEGPLD 422
++R ++EAL EKARL Q +E+ E ++ Q R R + E+ L
Sbjct: 408 EMRARVEALAEEKARLEQSREESLKESAEFAEKLRLSQERERELQEAQEAAAAQHAAQLA 467

Query: 423 ASAVDMDFLPLYPEEKD 473
A +P E+D
Sbjct: 468 AQREAQQLIPKDEGEED 484


>sp|Q02099|RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces
pombe GN=rad3 PE=1 SV=2
Length = 2386

Score = 29.3 bits (64), Expect = 9.6
Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%)
Frame = +1

Query: 49 IVQGLCCFKSSLPIHGMAS*SHGTHFVKSR-NLIIGGCSRIY 171
IVQ LCCF + HG+ H + S NL +G + Y
Sbjct: 282 IVQTLCCFSLNFIYHGLPICEKSKHILMSSINLTLGSLKKTY 323


>sp|Q8QGX4|PRKDC_CHICK DNA-dependent protein kinase catalytic subunit
OS=Gallus gallus GN=PRKDC PE=2 SV=1
Length = 4134

Score = 29.3 bits (64), Expect = 9.6
Identities = 13/35 (37%), Positives = 20/35 (57%)
Frame = +3

Query: 372 IGFPDESLMLDDEGPLDASAVDMDFLPLYPEEKDI 476
+GF D+ L ++EG L+ +A D+ P EK I
Sbjct: 3423 VGFCDQHLRKEEEGSLEINAADLQLFPAIVVEKMI 3457


>sp|A6UUW0|PCNA_META3 DNA polymerase sliding clamp OS=Methanococcus
aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pcn PE=3
SV=1
Length = 247

Score = 29.3 bits (64), Expect = 9.6
Identities = 13/44 (29%), Positives = 25/44 (56%)
Frame = -3

Query: 384 LETLYSATLADDIVQLHVETDFPLHTQHFLVPTLLSLQEGPQAE 253
L+ + AT ++DI+ +H+ TD P+ ++ + T L P+ E
Sbjct: 203 LKDITKATSSEDILHIHLGTDMPVKIEYIIGDTKLIYLLAPRIE 246


>sp|Q01844|EWS_HUMAN RNA-binding protein EWS OS=Homo sapiens
GN=EWSR1 PE=1 SV=1
Length = 656

Score = 29.3 bits (64), Expect = 9.6
Identities = 18/77 (23%), Positives = 30/77 (38%)
Frame = -3

Query: 291 PTLLSLQEGPQAEDGPVKRHEKGAYSAITCQMALTPAHPKIYTRTTSDYQVSTFDKMCTV 112
PT + PQA PV+ + GAY T + T A + + + +
Sbjct: 74 PTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAA 133

Query: 111 RSASHPMDRQRRLETAQ 61
+ + P D + ET+Q
Sbjct: 134 TAPTRPQDGNKPTETSQ 150


tr_hit_id A9SY78
Definition tr|A9SY78|A9SY78_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 59
Score (bit) 70.5
E-value 4.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917056|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_D03.
(479 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SY78|A9SY78_PHYPA Predicted protein OS=Physcomitrella paten... 70 4e-11
tr|Q1STQ5|Q1STQ5_MEDTR Putative uncharacterized protein OS=Medic... 69 1e-10
tr|A7NXY6|A7NXY6_VITVI Chromosome chr6 scaffold_3, whole genome ... 69 2e-10
tr|A5C343|A5C343_VITVI Putative uncharacterized protein OS=Vitis... 69 2e-10
tr|Q5WMS9|Q5WMS9_ORYSJ Os05g0315200 protein OS=Oryza sativa subs... 68 3e-10
tr|B6TIU7|B6TIU7_MAIZE Putative uncharacterized protein OS=Zea m... 68 3e-10
tr|A3B2I6|A3B2I6_ORYSJ Putative uncharacterized protein OS=Oryza... 68 3e-10
tr|A2Y343|A2Y343_ORYSI Putative uncharacterized protein OS=Oryza... 68 3e-10
tr|Q9LZN4|Q9LZN4_ARATH Putative uncharacterized protein T7H20_20... 67 3e-10
tr|Q9C8R6|Q9C8R6_ARATH Putative uncharacterized protein T1P2.7 (... 67 3e-10
tr|A7Q9V5|A7Q9V5_VITVI Chromosome chr8 scaffold_68, whole genome... 67 3e-10
tr|A5BVV2|A5BVV2_VITVI Putative uncharacterized protein OS=Vitis... 67 3e-10
tr|Q0DH96|Q0DH96_ORYSJ Os05g0481700 protein OS=Oryza sativa subs... 63 8e-09
tr|A2Y5U2|A2Y5U2_ORYSI Putative uncharacterized protein OS=Oryza... 63 8e-09
tr|Q84YE8|Q84YE8_SORBI Expressed protein-like protein OS=Sorghum... 60 4e-08
tr|O04342|O04342_ARATH Expressed protein (At2g30530/T6B20.12) OS... 60 4e-08
tr|Q2RBA7|Q2RBA7_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 60 7e-08
tr|B8BIS1|B8BIS1_ORYSI Putative uncharacterized protein OS=Oryza... 60 7e-08
tr|A3C814|A3C814_ORYSJ Putative uncharacterized protein OS=Oryza... 60 7e-08
tr|B8BNY6|B8BNY6_ORYSI Putative uncharacterized protein OS=Oryza... 59 9e-08
tr|B4F8G1|B4F8G1_MAIZE Putative uncharacterized protein OS=Zea m... 59 9e-08
tr|Q7X6C4|Q7X6C4_ORYSJ Os04g0228100 protein OS=Oryza sativa subs... 59 1e-07
tr|Q01MD0|Q01MD0_ORYSA H0209A05.2 protein OS=Oryza sativa GN=H02... 59 1e-07
tr|A3CEE4|A3CEE4_ORYSJ Putative uncharacterized protein OS=Oryza... 59 1e-07
tr|A2XPG5|A2XPG5_ORYSI Putative uncharacterized protein OS=Oryza... 59 1e-07
tr|Q9SY05|Q9SY05_ARATH Putative uncharacterized protein T5J8.12 ... 58 3e-07
tr|B6SSQ5|B6SSQ5_MAIZE Putative uncharacterized protein OS=Zea m... 58 3e-07
tr|Q84YF2|Q84YF2_SORBI BE599243-like protein OS=Sorghum bicolor ... 50 7e-05
tr|Q8TLV3|Q8TLV3_METAC Transcriptional regulator, ArsR family OS... 36 0.83
tr|A4SBD5|A4SBD5_OSTLU Predicted protein OS=Ostreococcus lucimar... 36 1.1

>tr|A9SY78|A9SY78_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_231634 PE=4 SV=1
Length = 384

Score = 70.5 bits (171), Expect = 4e-11
Identities = 39/59 (66%), Positives = 42/59 (71%), Gaps = 4/59 (6%)
Frame = +3

Query: 246 VRLQLEALLAEKARLVQENAAYARENQFLHEVVQYHQLRLR----SIGFPDESLMLDDE 410
VRLQLE LLAEK RL QENA YARENQFLHEVVQYHQ+ S+ PD M D+E
Sbjct: 312 VRLQLETLLAEKQRLQQENANYARENQFLHEVVQYHQIEFNEDELSVDGPDGFDMNDEE 370


>tr|Q1STQ5|Q1STQ5_MEDTR Putative uncharacterized protein OS=Medicago
truncatula GN=MtrDRAFT_AC136139g6v2 PE=4 SV=1
Length = 340

Score = 68.9 bits (167), Expect = 1e-10
Identities = 35/65 (53%), Positives = 46/65 (70%), Gaps = 4/65 (6%)
Frame = +3

Query: 246 VRLQLEALLAEKARLVQENAAYARENQFLHEVVQYHQLRLRSIGFPDESLM----LDDEG 413
+RLQLE LLAEKARL EN Y+REN+FL E+V+YHQL ++ + DES+ LD G
Sbjct: 237 IRLQLETLLAEKARLASENEVYSRENRFLREIVEYHQLTMQDVMHFDESMEEDTDLDLYG 296

Query: 414 PLDAS 428
P+D +
Sbjct: 297 PIDTT 301


>tr|A7NXY6|A7NXY6_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023914001
PE=4 SV=1
Length = 420

Score = 68.6 bits (166), Expect = 2e-10
Identities = 31/48 (64%), Positives = 40/48 (83%)
Frame = +3

Query: 246 VRLQLEALLAEKARLVQENAAYARENQFLHEVVQYHQLRLRSIGFPDE 389
+RLQLE LLAEKARL QEN+ YAREN+FL E+V+YHQL ++ + + DE
Sbjct: 284 IRLQLETLLAEKARLAQENSVYARENRFLREIVEYHQLTMQDVIYLDE 331


>tr|A5C343|A5C343_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_026199 PE=4 SV=1
Length = 190

Score = 68.6 bits (166), Expect = 2e-10
Identities = 31/48 (64%), Positives = 40/48 (83%)
Frame = +3

Query: 246 VRLQLEALLAEKARLVQENAAYARENQFLHEVVQYHQLRLRSIGFPDE 389
+RLQLE LLAEKARL QEN+ YAREN+FL E+V+YHQL ++ + + DE
Sbjct: 54 IRLQLETLLAEKARLAQENSVYARENRFLREIVEYHQLTMQDVIYLDE 101


>tr|Q5WMS9|Q5WMS9_ORYSJ Os05g0315200 protein OS=Oryza sativa subsp.
japonica GN=OJ1333_C12.2 PE=2 SV=1
Length = 419

Score = 67.8 bits (164), Expect = 3e-10
Identities = 30/50 (60%), Positives = 40/50 (80%)
Frame = +3

Query: 246 VRLQLEALLAEKARLVQENAAYARENQFLHEVVQYHQLRLRSIGFPDESL 395
+RLQLE LLAEKARL EN+ YAREN+FL E+V+YHQL ++ + + DE +
Sbjct: 303 IRLQLETLLAEKARLAHENSVYARENRFLREIVEYHQLTMQDVIYVDEGI 352


>tr|B6TIU7|B6TIU7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 374

Score = 67.8 bits (164), Expect = 3e-10
Identities = 30/50 (60%), Positives = 40/50 (80%)
Frame = +3

Query: 246 VRLQLEALLAEKARLVQENAAYARENQFLHEVVQYHQLRLRSIGFPDESL 395
+RLQLE LLAEKARL EN+ YAREN+FL E+V+YHQL ++ + + DE +
Sbjct: 290 IRLQLETLLAEKARLAHENSVYARENRFLREIVEYHQLTMQDVIYVDEGI 339


>tr|A3B2I6|A3B2I6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_017258 PE=4 SV=1
Length = 441

Score = 67.8 bits (164), Expect = 3e-10
Identities = 30/50 (60%), Positives = 40/50 (80%)
Frame = +3

Query: 246 VRLQLEALLAEKARLVQENAAYARENQFLHEVVQYHQLRLRSIGFPDESL 395
+RLQLE LLAEKARL EN+ YAREN+FL E+V+YHQL ++ + + DE +
Sbjct: 325 IRLQLETLLAEKARLAHENSVYARENRFLREIVEYHQLTMQDVIYVDEGI 374


>tr|A2Y343|A2Y343_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_19429 PE=4 SV=1
Length = 453

Score = 67.8 bits (164), Expect = 3e-10
Identities = 30/50 (60%), Positives = 40/50 (80%)
Frame = +3

Query: 246 VRLQLEALLAEKARLVQENAAYARENQFLHEVVQYHQLRLRSIGFPDESL 395
+RLQLE LLAEKARL EN+ YAREN+FL E+V+YHQL ++ + + DE +
Sbjct: 325 IRLQLETLLAEKARLAHENSVYARENRFLREIVEYHQLTMQDVIYVDEGI 374


>tr|Q9LZN4|Q9LZN4_ARATH Putative uncharacterized protein T7H20_20
OS=Arabidopsis thaliana GN=T7H20_20 PE=2 SV=1
Length = 351

Score = 67.4 bits (163), Expect = 3e-10
Identities = 30/48 (62%), Positives = 40/48 (83%)
Frame = +3

Query: 246 VRLQLEALLAEKARLVQENAAYARENQFLHEVVQYHQLRLRSIGFPDE 389
+RLQLE+LLAEKARL EN+ YAREN+FL E+V+YHQL ++ + + DE
Sbjct: 251 IRLQLESLLAEKARLAHENSVYARENRFLREIVEYHQLTMQDVVYIDE 298


>tr|Q9C8R6|Q9C8R6_ARATH Putative uncharacterized protein T1P2.7
(Putative uncharacterized protein) OS=Arabidopsis
thaliana GN=Krtap3-1 PE=2 SV=1
Length = 389

Score = 67.4 bits (163), Expect = 3e-10
Identities = 30/50 (60%), Positives = 40/50 (80%)
Frame = +3

Query: 246 VRLQLEALLAEKARLVQENAAYARENQFLHEVVQYHQLRLRSIGFPDESL 395
+RLQLE LLAEKARL EN+ YAREN+FL E+V+YHQL ++ + + DE +
Sbjct: 248 IRLQLETLLAEKARLAHENSIYARENRFLREIVEYHQLTMQDVVYIDEGI 297