BP917063
Clone id YMU001_000095_D11
Library
Length 568
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000095_D11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAAACCCTGCACATGTTGCACCACCACGGGACACTCCATTGCCACTTTCATCAGCATGGC
CATTAACATGGCACCGAACATCACCTTCACCTGCATATCATCACTTGTAGGCTCGGGTTC
CTCCACTTGGTCTCCACTGAACATATCGGTTTGCATTTCACCCTGCATCTTTGCATCACA
TACACATATATCTCCACCCACTTTCAAGAGATCAAACTCATCATACCTTGACTGAGACGA
CTCAGTCTCCCAACTCGTGTCAGCATCCATAGAGCTACTTTCACTTGGCTCAACCTCGTC
CTCTGTCTCAAGCTCGGGGAAGCTCCTCTAGTTTCACCGCTTCAATGTCATCTGCAAACC
GCACTCCTTGGCCTTTAACACCACTCGATGGAGCTTGAACCTCCATACCTTGACTTGGCA
ACACATCCTTTTCCTGATCGGGAACCACCGGCATATCTTCCACAATCGGAGCCACTCTAG
CTGGCATCCTCGGCATAGGAACCACCCTCTCTTTCTGAAGCCAAAGAACCCTCAGTTCCT
CTTGCACATACACTTCTCTTTGCACCAT
■■Homology search results ■■ -
sp_hit_id O18740
Definition sp|O18740|K1C9_CANFA Keratin, type I cytoskeletal 9 OS=Canis familiaris
Align length 47
Score (bit) 36.2
E-value 0.12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917063|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_D11.
(568 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O18740|K1C9_CANFA Keratin, type I cytoskeletal 9 OS=Canis fam... 36 0.12
sp|P04929|HRPX_PLALO Histidine-rich glycoprotein OS=Plasmodium l... 27 0.12
sp|Q6RHW0|K1C9_MOUSE Keratin, type I cytoskeletal 9 OS=Mus muscu... 34 0.44
sp|P47090|YJY5_YEAST Uncharacterized endoplasmic reticulum membr... 34 0.45
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=M... 33 0.75
sp|Q8CIS9|K1C9_RAT Keratin, type I cytoskeletal 9 OS=Rattus norv... 32 1.7
sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapi... 32 1.7
sp|P13645|K1C10_HUMAN Keratin, type I cytoskeletal 10 OS=Homo sa... 32 2.2
sp|Q551H4|FRAY2_DICDI Serine/threonine-protein kinase fray2 OS=D... 32 2.9
sp|Q66J97|R111C_XENLA E3 ubiquitin-protein ligase arkadia-C OS=X... 31 3.7
sp|Q6IMF3|K2C1_RAT Keratin, type II cytoskeletal 1 OS=Rattus nor... 31 3.7
sp|Q8MP30|Y7791_DICDI Uncharacterized histidine-rich protein DDB... 31 3.8
sp|P18165|LORI_MOUSE Loricrin OS=Mus musculus GN=Lor PE=2 SV=2 31 4.9
sp|P06394|K1C10_BOVIN Keratin, type I cytoskeletal 10 OS=Bos tau... 30 6.4
sp|Q8MUK3|CCNE_CAEBR G1/S-specific cyclin-E OS=Caenorhabditis br... 30 6.4
sp|Q90ZT7|R111A_XENLA E3 ubiquitin-protein ligase arkadia-A (Fra... 30 8.3
sp|A5A6M6|K2C1_PANTR Keratin, type II cytoskeletal 1 OS=Pan trog... 30 8.3
sp|P02535|K1C10_MOUSE Keratin, type I cytoskeletal 10 OS=Mus mus... 30 8.3
sp|Q5XIM5|CDV3_RAT Protein CDV3 homolog OS=Rattus norvegicus GN=... 30 8.3
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyce... 30 8.4

>sp|O18740|K1C9_CANFA Keratin, type I cytoskeletal 9 OS=Canis
familiaris GN=KRT9 PE=3 SV=1
Length = 786

Score = 36.2 bits (82), Expect = 0.12
Identities = 21/47 (44%), Positives = 24/47 (51%)
Frame = -3

Query: 533 EGSLASEREGGSYAEDAS*SGSDCGRYAGGSRSGKGCVAKSRYGGSS 393
EGS + R GGSY + G G Y GGS SG G + YGG S
Sbjct: 710 EGSGSGGRSGGSYGGGSGSGGRSGGSYGGGSGSGGG--SGGSYGGGS 754



Score = 35.8 bits (81), Expect = 0.15
Identities = 21/48 (43%), Positives = 24/48 (50%)
Frame = -3

Query: 533 EGSLASEREGGSYAEDAS*SGSDCGRYAGGSRSGKGCVAKSRYGGSSS 390
EGS + R GGSY + G Y GGS SG G + YGG SS
Sbjct: 600 EGSGSGGRSGGSYGGGSGSGGGSSCSYGGGSSSGGG--SGGSYGGGSS 645



Score = 32.0 bits (71), Expect = 2.2
Identities = 24/61 (39%), Positives = 30/61 (49%), Gaps = 6/61 (9%)
Frame = -3

Query: 554 SVCARGTEGSLASEREGGSYAEDAS*SGSDCGR------YAGGSRSGKGCVAKSRYGGSS 393
S C+ G GS + GGSY +S G G+ Y+GGS SG G + YGG S
Sbjct: 622 SSCSYGG-GSSSGGGSGGSYGGGSSSGGGSGGKGGSGCSYSGGSSSGGG--SGGSYGGGS 678

Query: 392 S 390
S
Sbjct: 679 S 679



Score = 32.0 bits (71), Expect = 2.2
Identities = 19/47 (40%), Positives = 22/47 (46%)
Frame = -3

Query: 530 GSLASEREGGSYAEDAS*SGSDCGRYAGGSRSGKGCVAKSRYGGSSS 390
GS + R GGSY + G G Y GGS S G S+ SSS
Sbjct: 725 GSGSGGRSGGSYGGGSGSGGGSGGSYGGGSGSKGGSGRSSQVQSSSS 771



Score = 31.2 bits (69), Expect = 3.7
Identities = 22/56 (39%), Positives = 24/56 (42%), Gaps = 6/56 (10%)
Frame = -3

Query: 539 GTEGSLASEREGGSYAEDAS*SGSDCGR------YAGGSRSGKGCVAKSRYGGSSS 390
G G GGSY +S G GR Y GGS SG G + YGG SS
Sbjct: 494 GGSGGSHGGGSGGSYGGGSSSGGGSGGRGGSGGSYGGGSGSGGG--SSGSYGGGSS 547



Score = 31.2 bits (69), Expect = 3.7
Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 6/53 (11%)
Frame = -3

Query: 530 GSLASEREGGSYAEDAS*SGSDCGRYAGGSRSGKGCVAK------SRYGGSSS 390
GS GGSY + G G Y GGS SG G YGG SS
Sbjct: 517 GSGGRGGSGGSYGGGSGSGGGSSGSYGGGSSSGGGSGGSHGGGSGGSYGGGSS 569



Score = 30.8 bits (68), Expect = 4.9
Identities = 19/47 (40%), Positives = 22/47 (46%)
Frame = -3

Query: 530 GSLASEREGGSYAEDAS*SGSDCGRYAGGSRSGKGCVAKSRYGGSSS 390
GS + GG E + G G Y GGS SG G + YGG SS
Sbjct: 587 GSGSGGGRGGGCEEGSGSGGRSGGSYGGGSGSGGG--SSCSYGGGSS 631



Score = 30.8 bits (68), Expect = 4.9
Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 4/50 (8%)
Frame = -3

Query: 530 GSLASEREGGSYAEDAS*SGSDCGRYAGGSRSGKGCVAK----SRYGGSS 393
GS G SY+ +S G G Y GGS SG+G + YGG S
Sbjct: 649 GSGGKGGSGCSYSGGSSSGGGSGGSYGGGSSSGRGSGGRGGSAGSYGGGS 698



Score = 30.0 bits (66), Expect = 8.3
Identities = 19/52 (36%), Positives = 22/52 (42%), Gaps = 3/52 (5%)
Frame = -3

Query: 542 RGTEGSLASEREGGSYA---EDAS*SGSDCGRYAGGSRSGKGCVAKSRYGGS 396
RG+ G GGS + S G G Y GGS SG G + GGS
Sbjct: 476 RGSRGGSGGSYGGGSSSGGGSGGSHGGGSGGSYGGGSSSGGGSGGRGGSGGS 527


>sp|P04929|HRPX_PLALO Histidine-rich glycoprotein OS=Plasmodium
lophurae PE=4 SV=1
Length = 351

Score = 27.3 bits (59), Expect(2) = 0.12
Identities = 19/71 (26%), Positives = 23/71 (32%)
Frame = +3

Query: 72 HRTSPSPAYHHL*ARVPPLGLH*TYRFAFHPASLHHIHIYLHPLSRDQTHHTLTETTQSP 251
H P P +HH PP H H + HH H H HH E
Sbjct: 94 HHHHPHPHHHH--HHHPPHHHHHLGHHHHHHHAAHHHHHEEHHHHHHAAHHHHHEEHHHH 151

Query: 252 NSCQHP*SYFH 284
+ H +FH
Sbjct: 152 HHAAHHHPWFH 162



Score = 27.3 bits (59), Expect(2) = 0.12
Identities = 16/55 (29%), Positives = 20/55 (36%)
Frame = +2

Query: 404 HTLTWQHILFLIGNHRHIFHNRSHSSWHPRHRNHPLFLKPKNPQFLLHIHFSLHH 568
H W H L +H H H+ H P H +H P H H + HH
Sbjct: 156 HHHPWFHHHHLGYHHHHAPHHHHHHHHAPHHHHH----HHHAPHHHHHHHHAPHH 206


>sp|Q6RHW0|K1C9_MOUSE Keratin, type I cytoskeletal 9 OS=Mus musculus
GN=Krt9 PE=1 SV=2
Length = 743

Score = 34.3 bits (77), Expect = 0.44
Identities = 18/50 (36%), Positives = 21/50 (42%)
Frame = -3

Query: 539 GTEGSLASEREGGSYAEDAS*SGSDCGRYAGGSRSGKGCVAKSRYGGSSS 390
G G + GG Y +S G G Y GGS G + YGG SS
Sbjct: 641 GGSGGSHGGKSGGGYGGGSSSGGGSGGSYGGGSGGSHGGKSGGSYGGGSS 690



Score = 33.5 bits (75), Expect = 0.75
Identities = 19/49 (38%), Positives = 23/49 (46%)
Frame = -3

Query: 539 GTEGSLASEREGGSYAEDAS*SGSDCGRYAGGSRSGKGCVAKSRYGGSS 393
G G + GGSY +S G G Y GGS SG G + YGG +
Sbjct: 671 GGSGGSHGGKSGGSYGGGSSSGGGSGGSYGGGSGSGGG--SGGSYGGGN 717



Score = 32.3 bits (72), Expect = 1.7
Identities = 17/49 (34%), Positives = 20/49 (40%)
Frame = -3

Query: 539 GTEGSLASEREGGSYAEDAS*SGSDCGRYAGGSRSGKGCVAKSRYGGSS 393
G G + GG Y +S G G Y GGS G + YGG S
Sbjct: 541 GGSGGSHGGKSGGGYGGGSSSGGGSGGSYGGGSGGSHGGGSGGSYGGGS 589



Score = 32.3 bits (72), Expect = 1.7
Identities = 17/49 (34%), Positives = 19/49 (38%)
Frame = -3

Query: 539 GTEGSLASEREGGSYAEDAS*SGSDCGRYAGGSRSGKGCVAKSRYGGSS 393
G G + GG Y S G G Y GGS G + YGG S
Sbjct: 587 GGSGGSHGGKSGGGYGGGTSSGGGSGGSYGGGSGGSHGGKSGGSYGGGS 635



Score = 30.8 bits (68), Expect = 4.9
Identities = 22/58 (37%), Positives = 26/58 (44%)
Frame = -3

Query: 566 GAKRSVCARGTEGSLASEREGGSYAEDAS*SGSDCGRYAGGSRSGKGCVAKSRYGGSS 393
G S C G GS S GG Y S +GS G + GGS G G + +GG S
Sbjct: 56 GGGFSACGGGGGGSFGSSY-GGGYGGGFS-TGSYSGMFGGGSGGGFGGGSGGGFGGGS 111



Score = 30.4 bits (67), Expect = 6.4
Identities = 19/52 (36%), Positives = 22/52 (42%), Gaps = 2/52 (3%)
Frame = -3

Query: 539 GTEGSLASEREGGSYAEDAS*S--GSDCGRYAGGSRSGKGCVAKSRYGGSSS 390
G G GGSY ++ S G G Y GGS G + YGG SS
Sbjct: 509 GKSGGSHGGGSGGSYGGESGGSHGGGSGGSYGGGSGGSHGGKSGGGYGGGSS 560



Score = 30.0 bits (66), Expect = 8.3
Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 2/48 (4%)
Frame = -3

Query: 530 GSLASEREGGSY--AEDAS*SGSDCGRYAGGSRSGKGCVAKSRYGGSS 393
GS + GGSY S G G Y GGS SG G + YGG S
Sbjct: 658 GSSSGGGSGGSYGGGSGGSHGGKSGGSYGGGSSSGGG--SGGSYGGGS 703


>sp|P47090|YJY5_YEAST Uncharacterized endoplasmic reticulum membrane
protein YJR015W OS=Saccharomyces cerevisiae GN=YJR015W
PE=1 SV=1
Length = 510

Score = 34.3 bits (77), Expect = 0.45
Identities = 24/68 (35%), Positives = 34/68 (50%)
Frame = -2

Query: 300 DEVEPSESSSMDADTSWETESSQSRYDEFDLLKVGGDICVCDAKMQGEMQTDMFSGDQVE 121
D++EP+ ++M+AD E R D DL V GD A QG D + D +
Sbjct: 6 DDIEPTAYNNMEAD-----EEYCRRNDIHDLSSVVGD-----AVSQGVPDMDGQTTDSSK 55

Query: 120 EPEPTSDD 97
+PEP S+D
Sbjct: 56 DPEPNSED 63


>sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus
musculus GN=Peg10 PE=1 SV=2
Length = 958

Score = 33.5 bits (75), Expect = 0.75
Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%)
Frame = +3

Query: 159 HPASLHHIHIYLHPLSRDQTHHTLTETTQ-SPNSCQHP*SYFH 284
HP LHH+H ++HP H L + P+ HP ++H
Sbjct: 545 HPYLLHHVHPHVHPHMHQHLHQHLHQFLHPDPHQYPHPDPHYH 587


>sp|Q8CIS9|K1C9_RAT Keratin, type I cytoskeletal 9 OS=Rattus
norvegicus GN=Krt9 PE=1 SV=1
Length = 618

Score = 32.3 bits (72), Expect = 1.7
Identities = 17/49 (34%), Positives = 21/49 (42%)
Frame = -3

Query: 539 GTEGSLASEREGGSYAEDAS*SGSDCGRYAGGSRSGKGCVAKSRYGGSS 393
G G + GGSY +S G G Y GGS G + +GG S
Sbjct: 492 GGSGGSHGGKSGGSYGGGSSSGGGSGGSYGGGSGGSHGGKSGGSHGGGS 540


>sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens
GN=KRT9 PE=1 SV=2
Length = 623

Score = 32.3 bits (72), Expect = 1.7
Identities = 19/49 (38%), Positives = 22/49 (44%)
Frame = -3

Query: 539 GTEGSLASEREGGSYAEDAS*SGSDCGRYAGGSRSGKGCVAKSRYGGSS 393
G+ GS GG Y + G G Y GGS SG G + YGG S
Sbjct: 492 GSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGG--SGGGYGGGS 538


>sp|P13645|K1C10_HUMAN Keratin, type I cytoskeletal 10 OS=Homo
sapiens GN=KRT10 PE=1 SV=4
Length = 593

Score = 32.0 bits (71), Expect = 2.2
Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 2/41 (4%)
Frame = -3

Query: 506 GGSYAEDAS*SGSDCGRYAGGSRSG--KGCVAKSRYGGSSS 390
GG Y +S GS G Y GGS SG G + +GGSSS
Sbjct: 496 GGGYGGGSSGGGSSGGGYGGGSSSGGHGGGSSSGGHGGSSS 536


>sp|Q551H4|FRAY2_DICDI Serine/threonine-protein kinase fray2
OS=Dictyostelium discoideum GN=fray2 PE=3 SV=1
Length = 1028

Score = 31.6 bits (70), Expect = 2.9
Identities = 28/98 (28%), Positives = 40/98 (40%), Gaps = 4/98 (4%)
Frame = +3

Query: 15 VAPPRDTPLPLSSAWPLTWHRTSPSPAYHHL---*ARVPPLGLH*TYRFAFHPASLHHI- 182
V PP PL L +A P+T +HHL +P + H +++H +
Sbjct: 466 VVPPPVVPLTLPTAIPVTAAAYHQQQQHHHLSHSSGSIPNHNASSNLGASAH-SNVHGLA 524

Query: 183 HIYLHPLSRDQTHHTLTETTQSPNSCQHP*SYFHLAQP 296
H +HP S T+ TQ P + Q P L QP
Sbjct: 525 HSSIHPTS-SAASTTVVNNTQQPQTLQPPQQQHQLQQP 561


>sp|Q66J97|R111C_XENLA E3 ubiquitin-protein ligase arkadia-C
OS=Xenopus laevis GN=rnf111-C PE=2 SV=1
Length = 967

Score = 31.2 bits (69), Expect = 3.7
Identities = 30/113 (26%), Positives = 35/113 (30%), Gaps = 13/113 (11%)
Frame = +3

Query: 3 NPAHVAPPRDTPLPLS----------SAWP--LTWHRTSPSPAYHHL*ARVPPLGLH*TY 146
NPA PP P P+ S P + H P P HHL PL H +
Sbjct: 640 NPASQPPPPPPPPPMDYVIAHQVPFISPLPSLTSTHAVPPPPPSHHLSTAAAPLPQHLS- 698

Query: 147 RFAFHPASLHHIHIYLHPLSRDQTHHTLTE-TTQSPNSCQHP*SYFHLAQPRP 302
H + HHI R H + Q QHP P P
Sbjct: 699 --TSHQSMSHHISATAPATQRLHAHEVIQRMEVQRRRMMQHPTRAHERPPPHP 749


tr_hit_id Q4T031
Definition tr|Q4T031|Q4T031_TETNG Chromosome undetermined SCAF11373, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis
Align length 68
Score (bit) 31.6
E-value 0.009
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917063|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_D11.
(568 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4T031|Q4T031_TETNG Chromosome undetermined SCAF11373, whole ... 34 0.009
tr|A0SYX1|A0SYX1_9BURK Putative uncharacterized protein OS=Janth... 38 0.34
tr|B4QBZ8|B4QBZ8_DROSI GD11861 OS=Drosophila simulans GN=GD11861... 38 0.34
tr|Q9W167|Q9W167_DROME CG13579 OS=Drosophila melanogaster GN=CG1... 37 0.59
tr|A9YU98|A9YU98_MEGAB Caudal' OS=Megaselia abdita GN=cad PE=2 SV=1 37 0.75
tr|A9YU97|A9YU97_MEGAB Caudal OS=Megaselia abdita GN=cad PE=2 SV=1 37 0.75
tr|A9YU96|A9YU96_MEGAB Caudal' OS=Megaselia abdita GN=cad PE=3 SV=1 37 0.75
tr|B4IHH0|B4IHH0_DROSE GM11863 OS=Drosophila sechellia GN=GM1186... 37 0.77
tr|B3NQK1|B3NQK1_DROER GG22970 OS=Drosophila erecta GN=GG22970 P... 37 0.77
tr|A7SNH8|A7SNH8_NEMVE Predicted protein (Fragment) OS=Nematoste... 36 1.7
tr|B4M305|B4M305_DROVI GJ19119 OS=Drosophila virilis GN=GJ19119 ... 35 2.2
tr|B4PBA5|B4PBA5_DROYA GE14409 OS=Drosophila yakuba GN=GE14409 P... 35 2.2
tr|A1L1H0|A1L1H0_XENLA LOC100036839 protein OS=Xenopus laevis GN... 35 3.7
tr|A8SPL8|A8SPL8_9FIRM Putative uncharacterized protein OS=Copro... 34 5.0
tr|Q66R65|Q66R65_YEAST YJR015W OS=Saccharomyces cerevisiae GN=YJ... 34 5.0
tr|A4YTQ1|A4YTQ1_BRASO Putative uncharacterized protein OS=Brady... 34 6.5
tr|A3UDP0|A3UDP0_9RHOB Putative uncharacterized protein OS=Ocean... 34 6.5
tr|Q26056|Q26056_PLALO Histidine-rich protein (Fragment) OS=Plas... 34 6.5
tr|Q7X8E2|Q7X8E2_ORYSJ OJ990528_30.2 protein (OSJNBa0076N16.23 p... 33 8.3
tr|Q01IA6|Q01IA6_ORYSA H0425E08.2 protein (OSIGBa0130B08.13 prot... 33 8.3
tr|B8AVV7|B8AVV7_ORYSI Putative uncharacterized protein OS=Oryza... 33 8.3
tr|A9QUN2|A9QUN2_BOMMO HnRNPA/B-like protein OS=Bombyx mori GN=h... 33 8.3
tr|A7RNT8|A7RNT8_NEMVE Predicted protein (Fragment) OS=Nematoste... 33 8.3
tr|Q6PUR8|Q6PUR8_DANRE Eukaryotic translation initiation factor ... 33 8.5
tr|Q6NYA7|Q6NYA7_DANRE Zgc:101532 protein (Fragment) OS=Danio re... 33 8.5
tr|Q1VEL5|Q1VEL5_VIBAL Putative uncharacterized protein OS=Vibri... 33 8.5
tr|B8ZLE7|B8ZLE7_STRPN Putative collagen-like surface-anchored p... 33 8.5
tr|B2DYU5|B2DYU5_STRPN G5 domain family OS=Streptococcus pneumon... 33 8.5
tr|A5M976|A5M976_STRPN G5 domain family protein OS=Streptococcus... 33 8.5
tr|A5LL28|A5LL28_STRPN G5 domain family protein OS=Streptococcus... 33 8.5

>tr|Q4T031|Q4T031_TETNG Chromosome undetermined SCAF11373, whole
genome shotgun sequence. (Fragment) OS=Tetraodon
nigroviridis GN=GSTENG00009544001 PE=4 SV=1
Length = 2172

Score = 31.6 bits (70), Expect(2) = 0.009
Identities = 24/68 (35%), Positives = 26/68 (38%), Gaps = 2/68 (2%)
Frame = +3

Query: 99 HHL*ARVPPLGLH*TYR--FAFHPASLHHIHIYLHPLSRDQTHHTLTETTQSPNSCQHP* 272
HHL + PL LH HP LHH+H LHPL H P HP
Sbjct: 1666 HHL---LHPLHLHHLLHPLHLLHPLHLHHLHHLLHPLHLLHPLH--------PLHLLHPL 1714

Query: 273 SYFHLAQP 296
HL P
Sbjct: 1715 YLHHLLHP 1722



Score = 30.4 bits (67), Expect(2) = 0.009
Identities = 22/59 (37%), Positives = 26/59 (44%), Gaps = 4/59 (6%)
Frame = +2

Query: 401 LHTLTWQHILFLIGNHRHIFHNRSHSSWHPRHRNHPLFLKP-KNPQFLLH---IHFSLH 565
LH L H L L H + H HP H HPL+L +P LLH +H LH
Sbjct: 1735 LHPLHLLHPLHLHHLHHLLHPLHLHHLLHPLHLLHPLYLHHLHHPLHLLHPLYLHHLLH 1793



Score = 33.9 bits (76), Expect(2) = 0.068
Identities = 34/101 (33%), Positives = 38/101 (37%), Gaps = 3/101 (2%)
Frame = +3

Query: 3 NPAHVAPPRDTPLPLSSAWPLTWHRT-SPSPAYH--HL*ARVPPLGLH*TYRFAFHPASL 173
+P H+ P PL PL H P H HL + PL L HP L
Sbjct: 1697 HPLHLLHPLH---PLHLLHPLYLHHLLHPLHLLHPLHLHHLLHPLHL-------LHPLHL 1746

Query: 174 HHIHIYLHPLSRDQTHHTLTETTQSPNSCQHP*SYFHLAQP 296
HH+H LHPL HH L P HP HL P
Sbjct: 1747 HHLHHLLHPL---HLHHLL-----HPLHLLHPLYLHHLHHP 1779



Score = 25.0 bits (53), Expect(2) = 0.068
Identities = 19/50 (38%), Positives = 22/50 (44%), Gaps = 2/50 (4%)
Frame = +2

Query: 404 HTLTWQHILFLIGNHRHIFHN-RSHSSWHPRHRNHPLFLKP-KNPQFLLH 547
H L H L+L H+ H H HP H HPL L +P LLH
Sbjct: 1778 HPLHLLHPLYL----HHLLHPLHLHHLLHPLHLLHPLHLHHLLHPLHLLH 1823


>tr|A0SYX1|A0SYX1_9BURK Putative uncharacterized protein
OS=Janthinobacterium lividum PE=4 SV=1
Length = 289

Score = 38.1 bits (87), Expect = 0.34
Identities = 20/50 (40%), Positives = 29/50 (58%)
Frame = -1

Query: 505 VVPMPRMPARVAPIVEDMPVVPDQEKDVLPSQGMEVQAPSSGVKGQGVRF 356
V+P+P +P +AP + PV P ++ LPSQ + + A SS K VRF
Sbjct: 43 VLPLPLVPPPLAPAIPAAPVAPASAEEALPSQTVMITA-SSDAKAPRVRF 91


>tr|B4QBZ8|B4QBZ8_DROSI GD11861 OS=Drosophila simulans GN=GD11861
PE=4 SV=1
Length = 744

Score = 38.1 bits (87), Expect = 0.34
Identities = 22/65 (33%), Positives = 26/65 (40%)
Frame = +2

Query: 359 PHSLAFNTTRWSLNLHTLTWQHILFLIGNHRHIFHNRSHSSWHPRHRNHPLFLKPKNPQF 538
PH T L +H H G H H++H SH HP H NHP P +P
Sbjct: 279 PHPHPHPTAAQQLQMHQHQQHHQQ--AGLHSHLYHGHSHHPSHPNHPNHP--NHPNHPHG 334

Query: 539 LLHIH 553
H H
Sbjct: 335 HPHHH 339


>tr|Q9W167|Q9W167_DROME CG13579 OS=Drosophila melanogaster
GN=CG13579 PE=1 SV=2
Length = 650

Score = 37.4 bits (85), Expect = 0.59
Identities = 18/50 (36%), Positives = 21/50 (42%)
Frame = +2

Query: 359 PHSLAFNTTRWSLNLHTLTWQHILFLIGNHRHIFHNRSHSSWHPRHRNHP 508
PH T L +H H G H H++H SH HP H NHP
Sbjct: 245 PHPHPHPTAAQQLQMHQHQQHHQQ--AGMHSHLYHGHSHHPSHPSHPNHP 292


>tr|A9YU98|A9YU98_MEGAB Caudal' OS=Megaselia abdita GN=cad PE=2 SV=1
Length = 344

Score = 37.0 bits (84), Expect = 0.75
Identities = 29/90 (32%), Positives = 38/90 (42%), Gaps = 9/90 (10%)
Frame = +3

Query: 27 RDTPLPLSSAWPLTWHRTSPS--PAYHHL*ARV------PPLGLH*TYRFAFHPASLHHI 182
RD P+P+ A + T P P HHL ++ PP+GLH LHH
Sbjct: 264 RDDPVPMMGA---DYMDTKPKIEPGAHHLLHQMQMHMAMPPMGLH--------HHGLHHP 312

Query: 183 HIYLHPLSRDQTHHTLTET-TQSPNSCQHP 269
H + H L + HH L +Q P S P
Sbjct: 313 HAHTHALLQQSQHHNLHPIHSQMPGSVPTP 342


>tr|A9YU97|A9YU97_MEGAB Caudal OS=Megaselia abdita GN=cad PE=2 SV=1
Length = 326

Score = 37.0 bits (84), Expect = 0.75
Identities = 29/90 (32%), Positives = 38/90 (42%), Gaps = 9/90 (10%)
Frame = +3

Query: 27 RDTPLPLSSAWPLTWHRTSPS--PAYHHL*ARV------PPLGLH*TYRFAFHPASLHHI 182
RD P+P+ A + T P P HHL ++ PP+GLH LHH
Sbjct: 246 RDDPVPMMGA---DYMDTKPKIEPGAHHLLHQMQMHMAMPPMGLH--------HHGLHHP 294

Query: 183 HIYLHPLSRDQTHHTLTET-TQSPNSCQHP 269
H + H L + HH L +Q P S P
Sbjct: 295 HAHTHALLQQSQHHNLHPIHSQMPGSVPTP 324


>tr|A9YU96|A9YU96_MEGAB Caudal' OS=Megaselia abdita GN=cad PE=3 SV=1
Length = 344

Score = 37.0 bits (84), Expect = 0.75
Identities = 29/90 (32%), Positives = 38/90 (42%), Gaps = 9/90 (10%)
Frame = +3

Query: 27 RDTPLPLSSAWPLTWHRTSPS--PAYHHL*ARV------PPLGLH*TYRFAFHPASLHHI 182
RD P+P+ A + T P P HHL ++ PP+GLH LHH
Sbjct: 264 RDDPVPMMGA---DYMDTKPKIEPGAHHLLHQMQMHMAMPPMGLH--------HHGLHHP 312

Query: 183 HIYLHPLSRDQTHHTLTET-TQSPNSCQHP 269
H + H L + HH L +Q P S P
Sbjct: 313 HAHTHALLQQSQHHNLHPIHSQMPGSVPTP 342


>tr|B4IHH0|B4IHH0_DROSE GM11863 OS=Drosophila sechellia GN=GM11863
PE=4 SV=1
Length = 712

Score = 37.0 bits (84), Expect = 0.77
Identities = 23/70 (32%), Positives = 28/70 (40%)
Frame = +2

Query: 359 PHSLAFNTTRWSLNLHTLTWQHILFLIGNHRHIFHNRSHSSWHPRHRNHPLFLKPKNPQF 538
PH T L +H H G H +++H SH HP H NHP P +P
Sbjct: 245 PHPHPHPTAAQQLQMHQHQQHHQQ--AGLHSYLYHGHSHHPSHPNHPNHP--NHPNHPNH 300

Query: 539 LLHIHFSLHH 568
H H HH
Sbjct: 301 HGHPH---HH 307


>tr|B3NQK1|B3NQK1_DROER GG22970 OS=Drosophila erecta GN=GG22970 PE=4
SV=1
Length = 710

Score = 37.0 bits (84), Expect = 0.77
Identities = 18/50 (36%), Positives = 21/50 (42%)
Frame = +2

Query: 359 PHSLAFNTTRWSLNLHTLTWQHILFLIGNHRHIFHNRSHSSWHPRHRNHP 508
PH T L +H H G H H++H SH HP H NHP
Sbjct: 255 PHPHPHPTAAQQLQMHQQHQHHQQ--AGMHSHLYHGHSHHPNHPSHPNHP 302


>tr|A7SNH8|A7SNH8_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g124851 PE=4 SV=1
Length = 204

Score = 35.8 bits (81), Expect = 1.7
Identities = 30/100 (30%), Positives = 41/100 (41%), Gaps = 20/100 (20%)
Frame = +3

Query: 12 HVAPPRD------TPLPLSSAW------PLTWHRTSPSPAYHHL*ARVPPLGLH*TYRFA 155
H+ PP +PLPL A+ P TWH T +P + + PL LH Y
Sbjct: 48 HITPPPSPGIQPISPLPLHLAYNPYHPSPFTWHTTHITPPPSPVIQPISPLPLHLAYN-P 106

Query: 156 FHPA--SLHHIHIY------LHPLSRDQTHHTLTETTQSP 251
+HP+ + H HI +HP+S H SP
Sbjct: 107 YHPSPFTWHTTHITPPPSPGIHPISPLPLHLAYNPYHPSP 146



Score = 35.4 bits (80), Expect = 2.2
Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 20/85 (23%)
Frame = +3

Query: 12 HVAPPRD------TPLPLSSAW------PLTWHRTSPSPAYHHL*ARVPPLGLH*TYRFA 155
H+ PP +PLPL A+ P TWH T +P + + PL LH Y
Sbjct: 118 HITPPPSPGIHPISPLPLHLAYNPYHPSPFTWHTTHITPPPSPVIQPISPLPLHLAYN-P 176

Query: 156 FHPA--SLHHIHIY------LHPLS 206
+HP+ + H HI +HP+S
Sbjct: 177 YHPSPFTWHTTHITPPPSPGIHPIS 201