BP917069
Clone id YMU001_000095_E06
Library
Length 485
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000095_E06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATCAGAGAGAATCTTTGATGTAGGAATTCCCAATAGAACTCTATCAAATTGATGAGATTT
GTCCTTGTGGGAAACTACCCTCAATAACTTTCATTGTACAGGCCACAACGTGGCAGGCTG
TGGCACAACATCTACACTCGCGAACATAACTTAGCTTGGGCAGTGTGCCGACACGTGATT
GTCACCTCCGATACCTAGATAGAGTTTTGGATCAACAACCATAGTACGAGGTCATGGAGC
TAGTAGCAGCATCATCCACGTGCGATGGTTGACCTCGATAGGTGACATGGGCATTCCATG
TCGACAATGGAGACAAAATGACAACAGCCAATCGATACCCACTCCACAGACACACGCCCT
CAACTCACATCCAATAATTGCAACCATTGACCACGTAAGCAACTGGGTTGCATGATGTAG
GCCAAGAACAAGTAAACTGACATCCACTCTTGCACTGGCATCAACCATTAAGTGCTTAAC
TACAA
■■Homology search results ■■ -
sp_hit_id Q64632
Definition sp|Q64632|ITB4_RAT Integrin beta-4 OS=Rattus norvegicus
Align length 63
Score (bit) 33.5
E-value 0.52
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917069|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_E06.
(485 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q64632|ITB4_RAT Integrin beta-4 OS=Rattus norvegicus GN=Itgb4... 33 0.52
sp|P59990|KR121_HUMAN Keratin-associated protein 12-1 OS=Homo sa... 32 1.5
sp|Q6PEX3|KR261_HUMAN Keratin-associated protein 26-1 OS=Homo sa... 27 2.6
sp|Q10313|YD61_SCHPO Uncharacterized protein C17G8.01c OS=Schizo... 30 4.4
sp|P59991|KR122_HUMAN Keratin-associated protein 12-2 OS=Homo sa... 30 4.4
sp|Q8IUC1|KR111_HUMAN Keratin-associated protein 11-1 OS=Homo sa... 30 5.7
sp|Q54DS4|Y2056_DICDI WD repeat-containing protein DDB_G0292056 ... 29 9.8
sp|Q2JT76|MRAY_SYNJA Phospho-N-acetylmuramoyl-pentapeptide-trans... 29 9.8

>sp|Q64632|ITB4_RAT Integrin beta-4 OS=Rattus norvegicus GN=Itgb4 PE=2
SV=1
Length = 1807

Score = 33.5 bits (75), Expect = 0.52
Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 1/63 (1%)
Frame = +2

Query: 182 SPPIPR*SFGSTTIVRGHGASSSIIHVRWLTSIG-DMGIPCRQWRQNDNSQSIPTPQTHA 358
SPP+PR G+ A S IH WL G MG + W Q D+ + H
Sbjct: 1121 SPPLPRGDLGAPQNPNAKAAGSRKIHFNWLPPPGKPMGYRVKYWVQGDSES-----EAHL 1175

Query: 359 LNS 367
L+S
Sbjct: 1176 LDS 1178


>sp|P59990|KR121_HUMAN Keratin-associated protein 12-1 OS=Homo
sapiens GN=KRTAP12-1 PE=1 SV=1
Length = 96

Score = 32.0 bits (71), Expect = 1.5
Identities = 15/46 (32%), Positives = 21/46 (45%)
Frame = -2

Query: 454 CKSGCQFTCSWPTSCNPVAYVVNGCNYWM*VEGVCLWSGYRLAVVI 317
C SGCQ C P+ C Y+ GC VC+ ++ AV +
Sbjct: 6 CSSGCQPACCAPSPCQASCYIPVGCQ-----SSVCVPVSFKPAVCV 46


>sp|Q6PEX3|KR261_HUMAN Keratin-associated protein 26-1 OS=Homo
sapiens GN=KRTAP26-1 PE=1 SV=1
Length = 210

Score = 26.9 bits (58), Expect(2) = 2.6
Identities = 10/14 (71%), Positives = 10/14 (71%)
Frame = -2

Query: 442 CQFTCSWPTSCNPV 401
CQ TC PTSC PV
Sbjct: 56 CQETCGEPTSCQPV 69



Score = 23.5 bits (49), Expect(2) = 2.6
Identities = 8/14 (57%), Positives = 9/14 (64%)
Frame = -2

Query: 421 PTSCNPVAYVVNGC 380
P SC P YV +GC
Sbjct: 109 PVSCRPQRYVSSGC 122


>sp|Q10313|YD61_SCHPO Uncharacterized protein C17G8.01c
OS=Schizosaccharomyces pombe GN=SPAC17G8.01c PE=2 SV=2
Length = 787

Score = 30.4 bits (67), Expect = 4.4
Identities = 12/38 (31%), Positives = 21/38 (55%)
Frame = +3

Query: 96 VQATTWQAVAQHLHSRT*LSLGSVPTRDCHLRYLDRVL 209
V + W+ QH+H + +G++ R HL + DRV+
Sbjct: 673 VNSRIWEQYLQHMHDKNTTKMGNISFRITHLVWDDRVI 710


>sp|P59991|KR122_HUMAN Keratin-associated protein 12-2 OS=Homo
sapiens GN=KRTAP12-2 PE=1 SV=1
Length = 146

Score = 30.4 bits (67), Expect = 4.4
Identities = 11/25 (44%), Positives = 13/25 (52%)
Frame = -2

Query: 454 CKSGCQFTCSWPTSCNPVAYVVNGC 380
C SGCQ C P+ C P V + C
Sbjct: 6 CSSGCQPACCAPSPCQPACCVPSSC 30


>sp|Q8IUC1|KR111_HUMAN Keratin-associated protein 11-1 OS=Homo
sapiens GN=KRTAP11-1 PE=1 SV=1
Length = 163

Score = 30.0 bits (66), Expect = 5.7
Identities = 17/48 (35%), Positives = 20/48 (41%)
Frame = -2

Query: 442 CQFTCSWPTSCNPVAYVVNGCNYWM*VEGVCLWSGYRLAVVILSPLST 299
CQ TC PT+C P Y C V C + R I +P ST
Sbjct: 56 CQETCCEPTACQPTCYRRTSC-----VSNPCQVTCSRQTTCISNPCST 98


>sp|Q54DS4|Y2056_DICDI WD repeat-containing protein DDB_G0292056
OS=Dictyostelium discoideum GN=DDB_G0292056 PE=4 SV=1
Length = 1823

Score = 29.3 bits (64), Expect = 9.8
Identities = 9/23 (39%), Positives = 15/23 (65%)
Frame = -3

Query: 363 LRACVCGVGIDWLLSFCLHCRHG 295
++ +C + + L SFCL+C HG
Sbjct: 1617 VKCSICNISVRGLSSFCLYCGHG 1639


>sp|Q2JT76|MRAY_SYNJA
Phospho-N-acetylmuramoyl-pentapeptide-transferase
OS=Synechococcus sp. (strain JA-3-3Ab) GN=mraY PE=3 SV=1
Length = 340

Score = 29.3 bits (64), Expect = 9.8
Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 2/33 (6%)
Frame = -3

Query: 420 LHHATQLLTWSMVAIIGC--ELRACVCGVGIDW 328
LHH +L WS V ++GC L A + G+G W
Sbjct: 302 LHHHLELGGWSEVQVVGCFYGLTALLVGLGWAW 334


tr_hit_id A8XLS1
Definition tr|A8XLS1|A8XLS1_CAEBR Putative uncharacterized protein OS=Caenorhabditis briggsae
Align length 68
Score (bit) 33.5
E-value 5.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917069|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_E06.
(485 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8XLS1|A8XLS1_CAEBR Putative uncharacterized protein OS=Caeno... 33 5.3
tr|Q0UEV6|Q0UEV6_PHANO Putative uncharacterized protein OS=Phaeo... 33 5.3
tr|Q5AX06|Q5AX06_EMENI Putative uncharacterized protein OS=Emeri... 33 9.1

>tr|A8XLS1|A8XLS1_CAEBR Putative uncharacterized protein
OS=Caenorhabditis briggsae GN=CBG15173 PE=4 SV=2
Length = 1039

Score = 33.5 bits (75), Expect = 5.3
Identities = 23/68 (33%), Positives = 31/68 (45%)
Frame = +2

Query: 266 WLTSIGDMGIPCRQWRQNDNSQSIPTPQTHALNSHPIIATIDHVSNWVA*CRPRTSKLTS 445
WLT + C R +D + SIP P T +S P + + H N C PR S T
Sbjct: 225 WLTEEEEAETLCSSNRPDDLNSSIPAPST---SSRPSLGSSSHEENPYTPC-PRRSDYTD 280

Query: 446 TLALASTI 469
+ L +TI
Sbjct: 281 SEFLGTTI 288


>tr|Q0UEV6|Q0UEV6_PHANO Putative uncharacterized protein
OS=Phaeosphaeria nodorum GN=SNOG_09708 PE=4 SV=1
Length = 217

Score = 33.5 bits (75), Expect = 5.3
Identities = 17/52 (32%), Positives = 25/52 (48%)
Frame = +2

Query: 308 WRQNDNSQSIPTPQTHALNSHPIIATIDHVSNWVA*CRPRTSKLTSTLALAS 463
W + Q +P PQ ++S P I + W + RP T LT+T A A+
Sbjct: 101 WHAAASVQPVPVPQARIVSSRPCDTAIAALRLWTSLWRPSTPTLTATPAQAT 152


>tr|Q5AX06|Q5AX06_EMENI Putative uncharacterized protein
OS=Emericella nidulans GN=AN7174.2 PE=4 SV=1
Length = 305

Score = 32.7 bits (73), Expect = 9.1
Identities = 18/56 (32%), Positives = 25/56 (44%)
Frame = +3

Query: 36 ELYQIDEICPCGKLPSITFIVQATTWQAVAQHLHSRT*LSLGSVPTRDCHLRYLDR 203
+LYQ+ E P GK Q W +A+H+ RT +DC RY +R
Sbjct: 18 DLYQVQEKAPTGK-------CQKINWNEIARHIPGRT--------NKDCRKRYYNR 58