BP917076
Clone id YMU001_000095_F01
Library
Length 533
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000095_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TAAGAAAGACAATCACCATTTCCTCTGCAGCTCATTTACGCCTGCTTACTCTTCCAAGGC
TGCAGAACTGCGACCACTATAATGACTATGATAATTAGCAGAATAATAATGGCTATACAC
ATCCATTTTCTAGAGTTCTTCTGCAAAGACTTTGCCCTTGGGAGTAATTTTGTCCCATCT
ACCACATGCTCCACGGCATTTGATACCTGCGTTTCAATATTGTCCAGCAATTCCCCTTGC
TCATCCACCAGTACAGCCATATTCAAGAATATCTGATGTAGATCCAAAAGCTTCCTCTCT
ATGTCTTTCACAGCATCATGTCGCTGCTGGATTTCATCCAAGGTATCCAATATCTGCCCT
CGTCCTTGCTCCTGAATAGCCTTGTGGAAAATTTGCTCACTATCTCCAGTTTCTATCAAG
CGATCTATGGTCTCTTCATCGAGCTTCTTCCCAGTTACTGTGAAAACTCGTCTTTCAACC
ACCTCTCTATACTCGCTATGAATCTTCTGCCTTAACGTCTGAAACTCATCCAT
■■Homology search results ■■ -
sp_hit_id Q8VZU2
Definition sp|Q8VZU2|SY132_ARATH Syntaxin-132 OS=Arabidopsis thaliana
Align length 165
Score (bit) 197.0
E-value 3.0e-50
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917076|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_F01.
(533 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8VZU2|SY132_ARATH Syntaxin-132 OS=Arabidopsis thaliana GN=SY... 197 3e-50
sp|Q9SRV7|SY131_ARATH Putative syntaxin-131 OS=Arabidopsis thali... 186 6e-47
sp|Q9ZQZ8|SY123_ARATH Syntaxin-123 OS=Arabidopsis thaliana GN=SY... 160 5e-39
sp|Q9SXB0|SY125_ARATH Syntaxin-125 OS=Arabidopsis thaliana GN=SY... 155 1e-37
sp|Q9ZSD4|SY121_ARATH Syntaxin-121 OS=Arabidopsis thaliana GN=SY... 154 2e-37
sp|O64791|SY124_ARATH Syntaxin-124 OS=Arabidopsis thaliana GN=SY... 151 2e-36
sp|Q9SVC2|SY122_ARATH Syntaxin-122 OS=Arabidopsis thaliana GN=SY... 146 5e-35
sp|Q42374|SY111_ARATH Syntaxin-related protein KNOLLE OS=Arabido... 137 4e-32
sp|Q9ZPV9|SY112_ARATH Syntaxin-112 OS=Arabidopsis thaliana GN=SY... 82 2e-15
sp|Q08849|STX3_RAT Syntaxin-3 OS=Rattus norvegicus GN=Stx3 PE=2 ... 72 2e-12
sp|Q64704|STX3_MOUSE Syntaxin-3 OS=Mus musculus GN=Stx3 PE=2 SV=1 72 2e-12
sp|Q13277|STX3_HUMAN Syntaxin-3 OS=Homo sapiens GN=STX3 PE=1 SV=3 71 4e-12
sp|Q24547|STX1A_DROME Syntaxin-1A OS=Drosophila melanogaster GN=... 70 5e-12
sp|Q9ER00|STX12_MOUSE Syntaxin-12 OS=Mus musculus GN=Stx12 PE=2 ... 69 1e-11
sp|Q16932|STX_APLCA Syntaxin OS=Aplysia californica PE=2 SV=1 68 2e-11
sp|Q5RBW6|STX12_PONAB Syntaxin-12 OS=Pongo abelii GN=STX12 PE=2 ... 67 7e-11
sp|Q86Y82|STX12_HUMAN Syntaxin-12 OS=Homo sapiens GN=STX12 PE=1 ... 67 7e-11
sp|Q3ZBT5|STX7_BOVIN Syntaxin-7 OS=Bos taurus GN=STX7 PE=2 SV=1 66 9e-11
sp|P50279|STX2_RAT Syntaxin-2 OS=Rattus norvegicus GN=Stx2 PE=2 ... 65 2e-10
sp|Q20574|STX2_CAEEL Putative syntaxin-2 OS=Caenorhabditis elega... 65 2e-10
sp|Q5R602|STX7_PONAB Syntaxin-7 OS=Pongo abelii GN=STX7 PE=2 SV=3 65 3e-10
sp|O15400|STX7_HUMAN Syntaxin-7 OS=Homo sapiens GN=STX7 PE=1 SV=4 65 3e-10
sp|Q00262|STX2_MOUSE Syntaxin-2 OS=Mus musculus GN=Stx2 PE=2 SV=1 64 5e-10
sp|O16000|STX1A_CAEEL Syntaxin-1A homolog OS=Caenorhabditis eleg... 64 5e-10
sp|A8WVD0|STX1A_CAEBR Syntaxin-1A OS=Caenorhabditis briggsae GN=... 64 5e-10
sp|P32856|STX2_HUMAN Syntaxin-2 OS=Homo sapiens GN=STX2 PE=2 SV=2 64 6e-10
sp|Q9USH7|PSY1_SCHPO Syntaxin-like protein psy1 OS=Schizosacchar... 64 6e-10
sp|P32851|STX1A_RAT Syntaxin-1A OS=Rattus norvegicus GN=Stx1a PE... 63 8e-10
sp|Q5R4L2|STX1A_PONAB Syntaxin-1A OS=Pongo abelii GN=STX1A PE=2 ... 63 8e-10
sp|Q16623|STX1A_HUMAN Syntaxin-1A OS=Homo sapiens GN=STX1A PE=1 ... 63 8e-10

>sp|Q8VZU2|SY132_ARATH Syntaxin-132 OS=Arabidopsis thaliana
GN=SYP132 PE=1 SV=1
Length = 304

Score = 197 bits (501), Expect = 3e-50
Identities = 102/165 (61%), Positives = 121/165 (73%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
M EFQ LR+ I V+TVTG++ DE+TID LIETG+SEQIF KAIQEQGRGQ
Sbjct: 140 MAEFQVLRENIQQEYRDVVDRRVYTVTGERADEDTIDELIETGNSEQIFQKAIQEQGRGQ 199

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
++DTL EIQ+RHDAV+D+E+KLLDL QIFL+MAVLVD QGE+LDNIE+QVS+AV+HV G
Sbjct: 200 VMDTLAEIQERHDAVRDLEKKLLDLQQIFLDMAVLVDAQGEMLDNIESQVSSAVDHVQSG 259

Query: 173 TKLLPRAKSLQKNSRKWMCXXXXXXXXXXXXXXXXXLQPWKSKQA 39
L RAKSLQKNSRKWMC L+PWK+K A
Sbjct: 260 NTALQRAKSLQKNSRKWMCIAIIILLIVVAVIVVGVLKPWKNKSA 304


>sp|Q9SRV7|SY131_ARATH Putative syntaxin-131 OS=Arabidopsis thaliana
GN=SYP131 PE=2 SV=1
Length = 306

Score = 186 bits (472), Expect = 6e-47
Identities = 97/163 (59%), Positives = 114/163 (69%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
+ EFQTLRQ I VFTVTG++ DEE IDRLIETGDSEQIF KAI+EQGRGQ
Sbjct: 141 ISEFQTLRQNIQQEYREVVERRVFTVTGQRADEEAIDRLIETGDSEQIFQKAIREQGRGQ 200

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
I+DTL EIQ+RHDAV+D+E+KLLDL Q+FL+MAVLVD QGE+LDNIE VS+AV+HV G
Sbjct: 201 IMDTLAEIQERHDAVRDLEKKLLDLQQVFLDMAVLVDAQGEMLDNIENMVSSAVDHVQSG 260

Query: 173 TKLLPRAKSLQKNSRKWMCXXXXXXXXXXXXXXXXXLQPWKSK 45
L +A QK+SRKWMC L+PW K
Sbjct: 261 NNQLTKAVKSQKSSRKWMCIAILILLIIIIITVISVLKPWTQK 303


>sp|Q9ZQZ8|SY123_ARATH Syntaxin-123 OS=Arabidopsis thaliana
GN=SYP123 PE=2 SV=1
Length = 305

Score = 160 bits (404), Expect = 5e-39
Identities = 78/139 (56%), Positives = 103/139 (74%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
MD+FQ LR K+ + FTVTG+K DEET+++LI +G+SE+ KAIQEQGRGQ
Sbjct: 142 MDDFQRLRTKMATEYKETVERRYFTVTGQKADEETVEKLISSGESERFLQKAIQEQGRGQ 201

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
++DTL EIQ+RHD VK+IER LL+LHQ+FL+MA LV+ QG +L++IE+ VS A V+ G
Sbjct: 202 VMDTLSEIQERHDTVKEIERSLLELHQVFLDMAALVEAQGNMLNDIESNVSKASSFVMRG 261

Query: 173 TKLLPRAKSLQKNSRKWMC 117
T L AK LQ+N+RKW C
Sbjct: 262 TDQLHGAKVLQRNNRKWAC 280


>sp|Q9SXB0|SY125_ARATH Syntaxin-125 OS=Arabidopsis thaliana
GN=SYP125 PE=2 SV=1
Length = 298

Score = 155 bits (392), Expect = 1e-37
Identities = 77/139 (55%), Positives = 100/139 (71%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
MD FQ LR ++++ FT+TG+K DE+TID LI +G+SE KAIQEQGRGQ
Sbjct: 134 MDSFQGLRARMNNEYKETVERRYFTITGEKADEQTIDNLIASGESENFLQKAIQEQGRGQ 193

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
ILDT+ EIQ+RHDAVK+IE+ LL+LHQ+FL+MA LV+ QG+ L+NIE+ V+ A V G
Sbjct: 194 ILDTISEIQERHDAVKEIEKNLLELHQVFLDMAALVEAQGQQLNNIESHVAKASSFVRRG 253

Query: 173 TKLLPRAKSLQKNSRKWMC 117
T L A+ QK+SRKW C
Sbjct: 254 TDQLQDAREYQKSSRKWTC 272


>sp|Q9ZSD4|SY121_ARATH Syntaxin-121 OS=Arabidopsis thaliana
GN=SYP121 PE=1 SV=1
Length = 346

Score = 154 bits (390), Expect = 2e-37
Identities = 80/162 (49%), Positives = 102/162 (62%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
MD F LR+ I S FTVTG+ DE T+DRLI TG+SE+ KAIQEQGRG+
Sbjct: 150 MDSFNRLRELISSEYRETVQRRYFTVTGENPDERTLDRLISTGESERFLQKAIQEQGRGR 209

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
+LDT++EIQ+RHDAVKDIE+ L +LHQ+FL+MAVLV+ QG LD+IE+ V A + G
Sbjct: 210 VLDTINEIQERHDAVKDIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGG 269

Query: 173 TKLLPRAKSLQKNSRKWMCXXXXXXXXXXXXXXXXXLQPWKS 48
T L A+ QKN+RKW C L+PW +
Sbjct: 270 TDQLQTARVYQKNTRKWTCIAIIILIIIITVVVLAVLKPWNN 311


>sp|O64791|SY124_ARATH Syntaxin-124 OS=Arabidopsis thaliana
GN=SYP124 PE=2 SV=1
Length = 303

Score = 151 bits (382), Expect = 2e-36
Identities = 74/139 (53%), Positives = 100/139 (71%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
MD FQ LR ++++ FT+TG++ DE+TI+ LI +G+SE KAIQEQGRGQ
Sbjct: 139 MDSFQGLRARMNAEYKETVERRYFTITGEQADEQTIENLISSGESENFLQKAIQEQGRGQ 198

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
ILDT+ EIQ+RHDAVK+IE+ L++LHQ+FL+MA LV+ QG+ L++IE+ VS A V G
Sbjct: 199 ILDTISEIQERHDAVKEIEKNLIELHQVFLDMAALVESQGQQLNDIESHVSKASSFVRRG 258

Query: 173 TKLLPRAKSLQKNSRKWMC 117
T L A+ QK+SRKW C
Sbjct: 259 TDQLQDAREYQKSSRKWTC 277


>sp|Q9SVC2|SY122_ARATH Syntaxin-122 OS=Arabidopsis thaliana
GN=SYP122 PE=1 SV=1
Length = 341

Score = 146 bits (369), Expect = 5e-35
Identities = 77/162 (47%), Positives = 102/162 (62%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
M++F +R+ I + FTVTG+ DE T++RLI TG+SE KAIQEQGRG+
Sbjct: 149 MEKFSRVRETITNEYKETVGRMCFTVTGEYPDEATLERLISTGESETFLQKAIQEQGRGR 208

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
ILDT++EIQ+RHDAVKDIE+ L +LHQ+FL+MAVLV+ QG LD+IE V A V G
Sbjct: 209 ILDTINEIQERHDAVKDIEKSLNELHQVFLDMAVLVEHQGAQLDDIEGNVKRANSLVRSG 268

Query: 173 TKLLPRAKSLQKNSRKWMCXXXXXXXXXXXXXXXXXLQPWKS 48
L +A+ QKN+RKW C ++PW+S
Sbjct: 269 ADRLVKARFYQKNTRKWTCFAILLLLIIVVLIVVFTVKPWES 310


>sp|Q42374|SY111_ARATH Syntaxin-related protein KNOLLE
OS=Arabidopsis thaliana GN=KN PE=1 SV=1
Length = 310

Score = 137 bits (344), Expect = 4e-32
Identities = 70/140 (50%), Positives = 96/140 (68%), Gaps = 1/140 (0%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLI-ETGDSEQIFHKAIQEQGRG 357
M EFQ LRQK+ S FTVTG+ ++E I+++I + E+ +AIQE G+G
Sbjct: 147 MMEFQGLRQKMMSEYKETVERRYFTVTGEHANDEMIEKIITDNAGGEEFLTRAIQEHGKG 206

Query: 356 QILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVD 177
++L+T+ EIQ R+DA K+IE+ LL+LHQ+FL+MAV+V+ QGE +D IE V NA +V D
Sbjct: 207 KVLETVVEIQDRYDAAKEIEKSLLELHQVFLDMAVMVESQGEQMDEIEHHVINASHYVAD 266

Query: 176 GTKLLPRAKSLQKNSRKWMC 117
G L AKS Q+NSRKWMC
Sbjct: 267 GANELKTAKSHQRNSRKWMC 286


>sp|Q9ZPV9|SY112_ARATH Syntaxin-112 OS=Arabidopsis thaliana
GN=SYP112 PE=2 SV=2
Length = 305

Score = 81.6 bits (200), Expect = 2e-15
Identities = 46/138 (33%), Positives = 75/138 (54%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
M EF LR++I + F TG++ E ++++I S K + +
Sbjct: 151 MSEFHRLRERIFADYREDLKRKYFLATGEEPSNEDMEKMISGSGSCSDLVKTFEVKPEMD 210

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
+ + ++RH+AV DI+R L LHQ+FL+MAVLV+ QG+ +D+IE V+NA V G
Sbjct: 211 L-----KTKERHEAVNDIKRSLNRLHQVFLDMAVLVETQGDRIDDIEANVANAGSFVSGG 265

Query: 173 TKLLPRAKSLQKNSRKWM 120
T L A ++K ++ W+
Sbjct: 266 TNSLYYANQMKKKTKSWV 283


>sp|Q08849|STX3_RAT Syntaxin-3 OS=Rattus norvegicus GN=Stx3 PE=2
SV=1
Length = 289

Score = 71.6 bits (174), Expect = 2e-12
Identities = 39/111 (35%), Positives = 62/111 (55%)
Frame = -1

Query: 458 VTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQILDTLDEIQQRHDAVKDIERKLLDL 279
+TGKK +E ++ ++E+G+ I Q Q L EI+ RH + +E + +L
Sbjct: 155 ITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQ---ALSEIEGRHKDIVRLESSIKEL 211

Query: 278 HQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDGTKLLPRAKSLQKNSRK 126
H +F+++A+LV+ QGE+LDNIE V + V+HV RA Q +RK
Sbjct: 212 HDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKARDETKRAMKYQGQARK 262


tr_hit_id A7Q015
Definition tr|A7Q015|A7Q015_VITVI Chromosome chr8 scaffold_41, whole genome shotgun sequence OS=Vitis vinifera
Align length 165
Score (bit) 195.0
E-value 1.0e-48
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917076|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_F01.
(533 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7Q015|A7Q015_VITVI Chromosome chr8 scaffold_41, whole genome... 195 1e-48
tr|A5B9I1|A5B9I1_VITVI Putative uncharacterized protein OS=Vitis... 195 1e-48
tr|B8BCZ1|B8BCZ1_ORYSI Putative uncharacterized protein OS=Oryza... 187 3e-46
tr|Q5VRF6|Q5VRF6_ORYSJ Os06g0168500 protein OS=Oryza sativa subs... 186 6e-46
tr|B7FJA0|B7FJA0_MEDTR Putative uncharacterized protein OS=Medic... 186 8e-46
tr|Q7XIE2|Q7XIE2_ORYSJ Os07g0164300 protein OS=Oryza sativa subs... 184 2e-45
tr|B8B7K4|B8B7K4_ORYSI Putative uncharacterized protein OS=Oryza... 184 2e-45
tr|A3BGV6|A3BGV6_ORYSJ Putative uncharacterized protein OS=Oryza... 184 2e-45
tr|B6U7P5|B6U7P5_MAIZE Syntaxin 132 OS=Zea mays PE=2 SV=1 182 7e-45
tr|B6TDM3|B6TDM3_MAIZE Syntaxin 132 OS=Zea mays PE=2 SV=1 181 2e-44
tr|A9T417|A9T417_PHYPA Qa-SNARE, Sso1/Syntaxin1-type, SYP13 grou... 181 2e-44
tr|A9U467|A9U467_PHYPA Qa-SNARE, Sso1/Syntaxin1-type, SYP13 grou... 180 5e-44
tr|A3B8S7|A3B8S7_ORYSJ Putative uncharacterized protein OS=Oryza... 174 3e-42
tr|A7PXH5|A7PXH5_VITVI Chromosome chr12 scaffold_36, whole genom... 173 4e-42
tr|A0F0A7|A0F0A7_NICBE Syntaxin (Fragment) OS=Nicotiana benthami... 171 2e-41
tr|A8HUY7|A8HUY7_CHLRE Qa-SNARE Sso1/Syntaxin1, PM-type OS=Chlam... 170 5e-41
tr|Q0WPM4|Q0WPM4_ARATH At4g03330 OS=Arabidopsis thaliana GN=At4g... 160 5e-38
tr|A9SA01|A9SA01_PHYPA Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-gro... 158 1e-37
tr|A9SNS7|A9SNS7_PHYPA Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-gro... 156 5e-37
tr|A4S8S3|A4S8S3_OSTLU Predicted protein OS=Ostreococcus lucimar... 156 5e-37
tr|Q3E7R5|Q3E7R5_ARATH Uncharacterized protein At3g11820.2 OS=Ar... 154 2e-36
tr|A9U4D6|A9U4D6_PHYPA Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-gro... 154 4e-36
tr|A9SA02|A9SA02_PHYPA Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-gro... 154 4e-36
tr|A9P217|A9P217_PICSI Putative uncharacterized protein OS=Picea... 153 6e-36
tr|Q69X85|Q69X85_ORYSJ Os06g0590500 protein OS=Oryza sativa subs... 151 2e-35
tr|A2YEK1|A2YEK1_ORYSI Putative uncharacterized protein OS=Oryza... 151 2e-35
tr|A0MED7|A0MED7_ARATH Putative uncharacterized protein (Fragmen... 151 2e-35
tr|A9SFE5|A9SFE5_PHYPA Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-gro... 150 4e-35
tr|A7PXF4|A7PXF4_VITVI Chromosome chr12 scaffold_36, whole genom... 148 1e-34
tr|Q9SML5|Q9SML5_CAPAN Knolle OS=Capsicum annuum GN=kn PE=2 SV=1 146 7e-34

>tr|A7Q015|A7Q015_VITVI Chromosome chr8 scaffold_41, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00027097001
PE=3 SV=1
Length = 307

Score = 195 bits (496), Expect = 1e-48
Identities = 102/165 (61%), Positives = 118/165 (71%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
M EFQ LR+ IH VFTVTG + DEETIDRLIETGDSEQIF KAIQEQGRGQ
Sbjct: 143 MAEFQVLRESIHQEYREVVERRVFTVTGTRADEETIDRLIETGDSEQIFQKAIQEQGRGQ 202

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
I+DTL EIQ+RHDAV+++ERKLLDL QIFL+MAVLVD QG++LDNIE+QVS+AV+HV G
Sbjct: 203 IMDTLAEIQERHDAVREVERKLLDLQQIFLDMAVLVDAQGDMLDNIESQVSSAVDHVQSG 262

Query: 173 TKLLPRAKSLQKNSRKWMCXXXXXXXXXXXXXXXXXLQPWKSKQA 39
L RAK LQ++SRKWMC L+PW A
Sbjct: 263 NTALQRAKKLQRSSRKWMCIAIIILLIIVVIIVVAVLKPWSKNGA 307


>tr|A5B9I1|A5B9I1_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_030563 PE=4 SV=1
Length = 204

Score = 195 bits (496), Expect = 1e-48
Identities = 102/165 (61%), Positives = 118/165 (71%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
M EFQ LR+ IH VFTVTG + DEETIDRLIETGDSEQIF KAIQEQGRGQ
Sbjct: 40 MAEFQVLRESIHQEYREVVERRVFTVTGTRADEETIDRLIETGDSEQIFQKAIQEQGRGQ 99

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
I+DTL EIQ+RHDAV+++ERKLLDL QIFL+MAVLVD QG++LDNIE+QVS+AV+HV G
Sbjct: 100 IMDTLAEIQERHDAVREVERKLLDLQQIFLDMAVLVDAQGDMLDNIESQVSSAVDHVQSG 159

Query: 173 TKLLPRAKSLQKNSRKWMCXXXXXXXXXXXXXXXXXLQPWKSKQA 39
L RAK LQ++SRKWMC L+PW A
Sbjct: 160 NTALQRAKKLQRSSRKWMCIAIIILLIIVVIIVVAVLKPWSKNGA 204


>tr|B8BCZ1|B8BCZ1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_30412 PE=4 SV=1
Length = 305

Score = 187 bits (475), Expect = 3e-46
Identities = 93/139 (66%), Positives = 113/139 (81%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
+ EFQTLR+ I VFTVTG++ DEETIDRLIETGDSEQIF +AIQEQGRG+
Sbjct: 145 ISEFQTLREAIQKEYRDVVERRVFTVTGERADEETIDRLIETGDSEQIFQRAIQEQGRGR 204

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
+LDTL EIQ+RHDAVK+IE+KLL+L QIFL+M+VLV+ QGE+LDNIE+QVS A EH+ G
Sbjct: 205 VLDTLQEIQERHDAVKEIEQKLLELQQIFLDMSVLVEAQGEILDNIESQVSGAAEHIQTG 264

Query: 173 TKLLPRAKSLQKNSRKWMC 117
T LL +A+ LQKN+RKW C
Sbjct: 265 TNLLQKARFLQKNTRKWTC 283


>tr|Q5VRF6|Q5VRF6_ORYSJ Os06g0168500 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0033B09.18 PE=3 SV=1
Length = 305

Score = 186 bits (472), Expect = 6e-46
Identities = 92/139 (66%), Positives = 113/139 (81%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
+ EFQTLR+ I VFTVTG++ DEETID+LIETGDSEQIF +AIQEQGRG+
Sbjct: 145 ISEFQTLREAIQKEYRDVVERRVFTVTGERADEETIDKLIETGDSEQIFQRAIQEQGRGR 204

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
+LDTL EIQ+RHDAVK+IE+KLL+L QIFL+M+VLV+ QGE+LDNIE+QVS A EH+ G
Sbjct: 205 VLDTLQEIQERHDAVKEIEQKLLELQQIFLDMSVLVEAQGEILDNIESQVSGAAEHIQTG 264

Query: 173 TKLLPRAKSLQKNSRKWMC 117
T LL +A+ LQKN+RKW C
Sbjct: 265 TNLLQKARFLQKNTRKWTC 283


>tr|B7FJA0|B7FJA0_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 307

Score = 186 bits (471), Expect = 8e-46
Identities = 97/162 (59%), Positives = 116/162 (71%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
M EFQTLRQ+I V TVTG + D+ETID LIETG+SEQIF AI E GRGQ
Sbjct: 145 MTEFQTLRQRIQDEYREVVERRVITVTGTRPDDETIDHLIETGNSEQIFQHAILEAGRGQ 204

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
++ T++EIQ+RHDAVK+IE+KLLDLHQI+L+MAVLV+ QGE+LDNIE+QV+NAV+HV G
Sbjct: 205 VVSTVEEIQERHDAVKEIEKKLLDLHQIYLDMAVLVEAQGEILDNIESQVNNAVDHVQRG 264

Query: 173 TKLLPRAKSLQKNSRKWMCXXXXXXXXXXXXXXXXXLQPWKS 48
T L AK LQKNSRKWMC L+PWKS
Sbjct: 265 TTALQSAKKLQKNSRKWMCIAIIILLIIVAIIVVGVLKPWKS 306


>tr|Q7XIE2|Q7XIE2_ORYSJ Os07g0164300 protein OS=Oryza sativa subsp.
japonica GN=P0039H02.103 PE=2 SV=1
Length = 303

Score = 184 bits (467), Expect = 2e-45
Identities = 93/161 (57%), Positives = 112/161 (69%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
MD+FQ LR+ I VFTVTG + DEET+D LIETG SEQIF +AIQ+QGRGQ
Sbjct: 140 MDDFQVLREAIRQEYRDVVERRVFTVTGSRPDEETVDNLIETGRSEQIFQEAIQQQGRGQ 199

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
ILDT+ EIQ+RHDAV+D+ERKLL+L QIF++MAVLVD QG++++NIET VSNA H+ G
Sbjct: 200 ILDTVAEIQERHDAVRDLERKLLELQQIFMDMAVLVDAQGDMINNIETHVSNATNHIQQG 259

Query: 173 TKLLPRAKSLQKNSRKWMCXXXXXXXXXXXXXXXXXLQPWK 51
L AK LQKNSRKWMC +QPWK
Sbjct: 260 VSALQNAKKLQKNSRKWMCYAIILLLIIVVIIVVAVIQPWK 300


>tr|B8B7K4|B8B7K4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_25009 PE=4 SV=1
Length = 303

Score = 184 bits (467), Expect = 2e-45
Identities = 93/161 (57%), Positives = 112/161 (69%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
MD+FQ LR+ I VFTVTG + DEET+D LIETG SEQIF +AIQ+QGRGQ
Sbjct: 140 MDDFQVLREAIRQEYRDVVERRVFTVTGSRPDEETVDNLIETGRSEQIFQEAIQQQGRGQ 199

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
ILDT+ EIQ+RHDAV+D+ERKLL+L QIF++MAVLVD QG++++NIET VSNA H+ G
Sbjct: 200 ILDTVAEIQERHDAVRDLERKLLELQQIFMDMAVLVDAQGDMINNIETHVSNATNHIQQG 259

Query: 173 TKLLPRAKSLQKNSRKWMCXXXXXXXXXXXXXXXXXLQPWK 51
L AK LQKNSRKWMC +QPWK
Sbjct: 260 VSALQNAKKLQKNSRKWMCYAIILLLIIVVIIVVAVIQPWK 300


>tr|A3BGV6|A3BGV6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_022278 PE=3 SV=1
Length = 321

Score = 184 bits (467), Expect = 2e-45
Identities = 93/161 (57%), Positives = 112/161 (69%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
MD+FQ LR+ I VFTVTG + DEET+D LIETG SEQIF +AIQ+QGRGQ
Sbjct: 158 MDDFQVLREAIRQEYRDVVERRVFTVTGSRPDEETVDNLIETGRSEQIFQEAIQQQGRGQ 217

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
ILDT+ EIQ+RHDAV+D+ERKLL+L QIF++MAVLVD QG++++NIET VSNA H+ G
Sbjct: 218 ILDTVAEIQERHDAVRDLERKLLELQQIFMDMAVLVDAQGDMINNIETHVSNATNHIQQG 277

Query: 173 TKLLPRAKSLQKNSRKWMCXXXXXXXXXXXXXXXXXLQPWK 51
L AK LQKNSRKWMC +QPWK
Sbjct: 278 VSALQNAKKLQKNSRKWMCYAIILLLIIVVIIVVAVIQPWK 318


>tr|B6U7P5|B6U7P5_MAIZE Syntaxin 132 OS=Zea mays PE=2 SV=1
Length = 304

Score = 182 bits (463), Expect = 7e-45
Identities = 94/161 (58%), Positives = 111/161 (68%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
MD+FQTLR+ I VFTVTG + DEETID LIETG SEQIF AIQ QGRGQ
Sbjct: 141 MDDFQTLREAIRQEYREVVERRVFTVTGNRPDEETIDDLIETGKSEQIFKDAIQHQGRGQ 200

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
ILDT+ EIQ+RHDAV+D+ERKLL+L QIF++MAVLV+ QG++++NIET VSNA H+ G
Sbjct: 201 ILDTVAEIQERHDAVRDLERKLLELQQIFMDMAVLVEAQGDMINNIETHVSNATNHIQQG 260

Query: 173 TKLLPRAKSLQKNSRKWMCXXXXXXXXXXXXXXXXXLQPWK 51
L AK LQKNSRKWMC +QPWK
Sbjct: 261 VSALQNAKKLQKNSRKWMCYAIILLLVIVAVIVVAVIQPWK 301


>tr|B6TDM3|B6TDM3_MAIZE Syntaxin 132 OS=Zea mays PE=2 SV=1
Length = 304

Score = 181 bits (460), Expect = 2e-44
Identities = 93/161 (57%), Positives = 111/161 (68%)
Frame = -1

Query: 533 MDEFQTLRQKIHSXXXXXXXXXVFTVTGKKLDEETIDRLIETGDSEQIFHKAIQEQGRGQ 354
MD+FQTLR+ I VFTVTG + DEETID LIETG SEQIF AIQ QGRGQ
Sbjct: 141 MDDFQTLREAIRQEYREVVERRVFTVTGNRPDEETIDDLIETGKSEQIFKDAIQHQGRGQ 200

Query: 353 ILDTLDEIQQRHDAVKDIERKLLDLHQIFLNMAVLVDEQGELLDNIETQVSNAVEHVVDG 174
ILDT+ EIQ+RHDAV+D+ERKLL+L QIF++MAVLV+ QG++++NIET VSNA H+ G
Sbjct: 201 ILDTVAEIQERHDAVRDLERKLLELQQIFMDMAVLVEAQGDMINNIETHVSNATNHIQQG 260

Query: 173 TKLLPRAKSLQKNSRKWMCXXXXXXXXXXXXXXXXXLQPWK 51
L AK LQ+NSRKWMC +QPWK
Sbjct: 261 VSALQNAKKLQRNSRKWMCYAIIILLVIVVVIVVAVIQPWK 301