BP917094
Clone id YMU001_000095_G10
Library
Length 342
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000095_G10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AATGGGATAAAATGATCTCTGTATTGATAGAGCTAGCTCTGCATGTGTGGATTATTAGCA
TAGAAGAATTCTACGTGAACGGTATACATATATACTTGAGCATATAGCTATTGACCTACA
CTAACTAAACATCCGCCTGATTGTATATAAGAAAACCCCTCTTGATGGGTAGAGAAAATC
TGAACCTGCTCACCTCTTAGGTTCTTTAACCTCAAAATGTAGGAAAAGGTCATTTCTATC
AAAAATGTGTAAAAGCCACTTAACAGGCTGTTCCCTTGATGCATCAAGAATTCTAAAGCA
TGGCCTAGAAGCTTGTCTTAGATGCTGCATGGTAACGTTCCA
■■Homology search results ■■ -
sp_hit_id Q8IWY9
Definition sp|Q8IWY9|CDAN1_HUMAN Codanin-1 OS=Homo sapiens
Align length 55
Score (bit) 29.6
E-value 4.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917094|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_G10.
(323 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8IWY9|CDAN1_HUMAN Codanin-1 OS=Homo sapiens GN=CDAN1 PE=1 SV=3 30 4.8
sp|Q9VWR8|DPY19_DROME Protein dpy-19 homolog OS=Drosophila melan... 29 6.3

>sp|Q8IWY9|CDAN1_HUMAN Codanin-1 OS=Homo sapiens GN=CDAN1 PE=1 SV=3
Length = 1227

Score = 29.6 bits (65), Expect = 4.8
Identities = 17/55 (30%), Positives = 25/55 (45%)
Frame = +2

Query: 131 IRLIVYKKTPLDG*RKSEPAHLLGSLTSKCRKRSFLSKMCKSHLTGCSLDASRIL 295
+ L V + P +G LLG L R R FL + HL CS++ + +L
Sbjct: 1035 LSLAVGPRDPDEGVSPEHLEQLLGQLGQTLRCRQFLCPPAEQHLAKCSVELASLL 1089


>sp|Q9VWR8|DPY19_DROME Protein dpy-19 homolog OS=Drosophila
melanogaster GN=CG6659 PE=1 SV=1
Length = 872

Score = 29.3 bits (64), Expect = 6.3
Identities = 16/39 (41%), Positives = 21/39 (53%)
Frame = -1

Query: 311 LLGHALEFLMHQGNSLLSGFYTFLIEMTFSYILRLKNLR 195
LLGHAL F+M GNS L + I + I ++ LR
Sbjct: 265 LLGHALAFVMSHGNSQLLLTWQLSISLFLFLITMVRQLR 303


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917094|Adiantum capillus-veneris mRNA, clone:
YMU001_000095_G10.
(323 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******