BP917119
Clone id YMU001_000096_C02
Library
Length 495
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000096_C02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CACGGCATATCAAATCATCAAGCAGCTCATTATGAGCATGTGCATGTGCTTTCACGCGCA
CAAGCCGCGCACAAGCACTCTCACCATGTACCGGGATCGACTTTTCCCTGGAGAACTTAA
CAATGTAAGGAAAGACTGTCTCTCCATCTAGCTTGTGAATCTCATTTTCATAAAAACACA
CACATACTAGACCTTGAATGCTAAAAAAGTTTACCCACACAACTCCATTACCTTAAAACA
CTATCAAGCCTACTGCCTCTAGGACCACTCTCACTATATCCTCGGTAGGCAATCATCTCC
TTACAATCTTTCACTTTACCTGACGGGTACACCTGAATCAAACCGTAGTCTTGCAATTAC
TTCCAGCAACAGCACAAGACGTTTGTCCATGGTTTCGCGCTTAACTTGAAGTTAAAGCCT
CACGGTGGCCAGACAGTGAGTAAAATCCACCTTTCATTGATACGCCATGGTCAGAAGGAC
CAGATTCTTAGACAA
■■Homology search results ■■ -
sp_hit_id Q54QR1
Definition sp|Q54QR1|LIMA_DICDI LIM domain-containing protein A OS=Dictyostelium discoideum
Align length 65
Score (bit) 29.6
E-value 8.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917119|Adiantum capillus-veneris mRNA, clone:
YMU001_000096_C02.
(495 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q54QR1|LIMA_DICDI LIM domain-containing protein A OS=Dictyost... 30 8.0

>sp|Q54QR1|LIMA_DICDI LIM domain-containing protein A
OS=Dictyostelium discoideum GN=limA PE=2 SV=1
Length = 1183

Score = 29.6 bits (65), Expect = 8.0
Identities = 19/65 (29%), Positives = 27/65 (41%), Gaps = 4/65 (6%)
Frame = +1

Query: 1 HGISNHQAAHYEHVHVLSRAQAAHKHSHHVPGSTFPWRT*QCKERLSL----HLACESHF 168
H H +H +H H +H H+H P +T + Q + LS H A SH
Sbjct: 713 HSHPQHPHSHPQHPHSHPHQSHSHSHAHSQPTTTVQPQQ-QQQHSLSTVVHPHNATPSHH 771

Query: 169 HKNTH 183
H + H
Sbjct: 772 HHHQH 776


tr_hit_id B3MNX0
Definition tr|B3MNX0|B3MNX0_DROAN GF15685 OS=Drosophila ananassae
Align length 61
Score (bit) 35.4
E-value 1.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917119|Adiantum capillus-veneris mRNA, clone:
YMU001_000096_C02.
(495 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3MNX0|B3MNX0_DROAN GF15685 OS=Drosophila ananassae GN=GF1568... 35 1.5
tr|A8PCQ6|A8PCQ6_BRUMA F-box domain containing protein OS=Brugia... 34 3.3
tr|A5EBP4|A5EBP4_BRASB Putative High affinity nickel transporter... 34 4.4
tr|A7RFL2|A7RFL2_NEMVE Predicted protein (Fragment) OS=Nematoste... 34 4.4

>tr|B3MNX0|B3MNX0_DROAN GF15685 OS=Drosophila ananassae GN=GF15685
PE=4 SV=1
Length = 1293

Score = 35.4 bits (80), Expect = 1.5
Identities = 20/61 (32%), Positives = 24/61 (39%)
Frame = +1

Query: 1 HGISNHQAAHYEHVHVLSRAQAAHKHSHHVPGSTFPWRT*QCKERLSLHLACESHFHKNT 180
H HQ H H H H H HH G P R Q ++LS H H H++
Sbjct: 992 HQQHQHQHLHMHHHHHHHHGSQQHHHHHHQHGHQDPSRPSQHHQQLSNH---HHHHHQHP 1048

Query: 181 H 183
H
Sbjct: 1049 H 1049


>tr|A8PCQ6|A8PCQ6_BRUMA F-box domain containing protein OS=Brugia
malayi GN=Bm1_22070 PE=4 SV=1
Length = 303

Score = 34.3 bits (77), Expect = 3.3
Identities = 15/45 (33%), Positives = 25/45 (55%)
Frame = +2

Query: 26 LIMSMCMCFHAHKPRTSTLTMYRDRLFPGELNNVRKDCLSI*LVN 160
L ++CMCF H P + L MY +L L ++ + C ++ +VN
Sbjct: 208 LTYNVCMCFAVHCPNLTVLNMYGIQLTNSSLKSLGRHCPNLEIVN 252


>tr|A5EBP4|A5EBP4_BRASB Putative High affinity nickel transporter
OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
GN=BBta_1353 PE=4 SV=1
Length = 406

Score = 33.9 bits (76), Expect = 4.4
Identities = 11/29 (37%), Positives = 17/29 (58%)
Frame = +1

Query: 1 HGISNHQAAHYEHVHVLSRAQAAHKHSHH 87
HG +H H++H H +++A H H HH
Sbjct: 242 HGHDHHGHHHHDHAHAVAQAHVHHHHVHH 270


>tr|A7RFL2|A7RFL2_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g72006 PE=4 SV=1
Length = 275

Score = 33.9 bits (76), Expect = 4.4
Identities = 19/73 (26%), Positives = 37/73 (50%)
Frame = +1

Query: 1 HGISNHQAAHYEHVHVLSRAQAAHKHSHHVPGSTFPWRT*QCKERLSLHLACESHFHKNT 180
H ISN AH + H++ + +H H+ ++ QC + + H S+ H++T
Sbjct: 176 HHISN---AHQPYSHIIYPMRTSHTHTSYI----------QCAQAIPTHHI--SNAHRHT 220

Query: 181 HILDLEC*KSLPT 219
H ++C +++PT
Sbjct: 221 HTSYIQCAQAIPT 233