BP917142
Clone id YMU001_000096_F04
Library
Length 189
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000096_F04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTCCTACAAACCGATAGTGACAAGCCTCCAAATTCTCCCTTCATCGGATCAATTGTTAGG
AGATTGCCTTCACTACCCCTTTCAAACCTTTTTCAAACTCCCAATCACCATCCACTACAG
ACCTAATCCAATTTGTTCAGCCTTCCTTTACTACGTGACATCCACACCAGCCATCCCCAA
ACAATGCAC
■■Homology search results ■■ -
sp_hit_id Q9VQU9
Definition sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster
Align length 49
Score (bit) 32.0
E-value 1.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917142|Adiantum capillus-veneris mRNA, clone:
YMU001_000096_F04.
(189 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster G... 32 1.0
sp|Q8PZJ7|ACKA_METMA Acetate kinase OS=Methanosarcina mazei GN=a... 30 3.8
sp|P05769|POLG_MVEV5 Genome polyprotein OS=Murray valley encepha... 29 6.5

>sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster
GN=bowl PE=1 SV=1
Length = 744

Score = 32.0 bits (71), Expect = 1.0
Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 11/49 (22%)
Frame = +1

Query: 1 VLQTDSDKPPNSP----------FIGSIVRRLPSLPLSNL-FQTPNHHP 114
+ Q +S KPPN P F+GSI R LP L P+HHP
Sbjct: 625 ITQPESGKPPNQPLHSPHEAMPSFLGSIPMRKRILPAPTLDLMDPHHHP 673


>sp|Q8PZJ7|ACKA_METMA Acetate kinase OS=Methanosarcina mazei GN=ackA
PE=3 SV=2
Length = 408

Score = 30.0 bits (66), Expect = 3.8
Identities = 13/41 (31%), Positives = 22/41 (53%)
Frame = +1

Query: 25 PPNSPFIGSIVRRLPSLPLSNLFQTPNHHPLQT*SNLFSLP 147
PPN I S +P +P+ +F T HH + + +++LP
Sbjct: 125 PPNMMGISSCQEIMPGVPMVAVFDTAFHHTIPPYAYMYALP 165


>sp|P05769|POLG_MVEV5 Genome polyprotein OS=Murray valley encephalitis
virus (strain MVE-1-51) PE=1 SV=2
Length = 3434

Score = 29.3 bits (64), Expect = 6.5
Identities = 13/40 (32%), Positives = 21/40 (52%)
Frame = -3

Query: 184 LFGDGWCGCHVVKEG*TNWIRSVVDGDWEFEKGLKGVVKA 65
+ G G H V + WI S ++G W+ E+ + G VK+
Sbjct: 976 IIGTAVKGNHAVHSDLSYWIESGLNGTWKLERAIFGEVKS 1015


tr_hit_id B4L9X7
Definition tr|B4L9X7|B4L9X7_DROMO GI14159 OS=Drosophila mojavensis
Align length 42
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917142|Adiantum capillus-veneris mRNA, clone:
YMU001_000096_F04.
(189 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4L9X7|B4L9X7_DROMO GI14159 OS=Drosophila mojavensis GN=GI141... 34 4.2
tr|Q5AQD8|Q5AQD8_EMENI Putative uncharacterized protein OS=Emeri... 33 7.2
tr|P79045|P79045_EMENI DNA binding regulatory protein AmdX OS=Em... 33 7.2

>tr|B4L9X7|B4L9X7_DROMO GI14159 OS=Drosophila mojavensis GN=GI14159
PE=4 SV=1
Length = 1021

Score = 33.9 bits (76), Expect = 4.2
Identities = 20/42 (47%), Positives = 23/42 (54%)
Frame = +1

Query: 22 KPPNSPFIGSIVRRLPSLPLSNLFQTPNHHPLQT*SNLFSLP 147
+PP SP+ R SLPLSNL TP PL LF+LP
Sbjct: 324 RPPLSPY-----RLRSSLPLSNLIDTPPSSPLTPVGVLFNLP 360


>tr|Q5AQD8|Q5AQD8_EMENI Putative uncharacterized protein
OS=Emericella nidulans GN=AN9492.2 PE=4 SV=1
Length = 1150

Score = 33.1 bits (74), Expect = 7.2
Identities = 15/42 (35%), Positives = 22/42 (52%)
Frame = +3

Query: 48 INC*EIAFTTPFKPFSNSQSPSTTDLIQFVQPSFTT*HPHQP 173
I C ++ + P S +Q PST D+ +F+ T HPH P
Sbjct: 488 IQCRDLYSRSSSSPTSTNQLPSTADMQRFISAYITYFHPHLP 529


>tr|P79045|P79045_EMENI DNA binding regulatory protein AmdX
OS=Emericella nidulans GN=amdX PE=4 SV=1
Length = 1150

Score = 33.1 bits (74), Expect = 7.2
Identities = 15/42 (35%), Positives = 22/42 (52%)
Frame = +3

Query: 48 INC*EIAFTTPFKPFSNSQSPSTTDLIQFVQPSFTT*HPHQP 173
I C ++ + P S +Q PST D+ +F+ T HPH P
Sbjct: 487 IQCRDLYSRSSSSPTSTNQLPSTADMQRFISAYITYFHPHLP 528