BP917167
Clone id YMU001_000097_B05
Library
Length 489
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000097_B05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AAGTACCTGCGAGAGAGAGAGGTAAATAATCTTGCACATTGTTGGCCTCAAATCCTAGGC
CCCCAAGTGCAAATCACATTGTGTACTAAAGTACTTGATGTTTAATTATTTGTGTTAGAG
TGAAGGCCCATCTTTTTTAAGTAGTTATTTGTGTGCAGACAAGGGCATAACAATGTGCAC
GTAGATTGATTCTCAAGTTCCTCATTGAAATCATAACAAGCTACAACAAATTCAAGAGAA
TTGTAGCAAAGTTCCTTTTTTTCAAGAAAATCATGAATTTTCTTAACTATAGCAAATTTC
CTTCTTTTTGAGAAAATCACGAATTTTCTTAACTATAATTCAGTTAAGAAGCTCAATCTT
CCACAAATGGCCATGTCACATTGTTAGAAGGTAGCATTGATTAACAGGCACGACACCAAA
GTCAAGGATACTCAAGTTAAAGATGCCTCTGCAAGGGAAGGAGTTTCTTCAAGAATACAT
CAATGTTTT
■■Homology search results ■■ -
sp_hit_id Q6TND0
Definition sp|Q6TND0|MATK_DALWR Maturase K OS=Dalea wrightii
Align length 28
Score (bit) 30.8
E-value 3.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917167|Adiantum capillus-veneris mRNA, clone:
YMU001_000097_B05.
(489 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6TND0|MATK_DALWR Maturase K OS=Dalea wrightii GN=matK PE=3 SV=1 31 3.4
sp|Q6TND4|MATK_DALPU Maturase K OS=Dalea purpurea GN=matK PE=3 SV=1 31 3.4
sp|P15804|CAPP3_SORBI Phosphoenolpyruvate carboxylase 3 OS=Sorgh... 30 5.8

>sp|Q6TND0|MATK_DALWR Maturase K OS=Dalea wrightii GN=matK PE=3 SV=1
Length = 512

Score = 30.8 bits (68), Expect = 3.4
Identities = 14/28 (50%), Positives = 18/28 (64%)
Frame = +3

Query: 207 EIITSYNKFKRIVAKFLFFKKIMNFLNY 290
E+I SYNK + I A F FF+ +LNY
Sbjct: 122 EVIKSYNKLRSIHAIFPFFEDKFTYLNY 149


>sp|Q6TND4|MATK_DALPU Maturase K OS=Dalea purpurea GN=matK PE=3 SV=1
Length = 509

Score = 30.8 bits (68), Expect = 3.4
Identities = 14/28 (50%), Positives = 18/28 (64%)
Frame = +3

Query: 207 EIITSYNKFKRIVAKFLFFKKIMNFLNY 290
E+I SYNK + I A F FF+ +LNY
Sbjct: 119 EVIKSYNKLRSIHAIFPFFEDKFTYLNY 146


>sp|P15804|CAPP3_SORBI Phosphoenolpyruvate carboxylase 3 OS=Sorghum
bicolor PE=1 SV=2
Length = 960

Score = 30.0 bits (66), Expect = 5.8
Identities = 14/27 (51%), Positives = 18/27 (66%)
Frame = -2

Query: 314 FSKRRKFAIVKKIHDFLEKKELCYNSL 234
FS+ + A+ KI +FLE ELCY SL
Sbjct: 388 FSEISEDAVFTKIEEFLEPLELCYKSL 414


tr_hit_id Q3LWD7
Definition tr|Q3LWD7|Q3LWD7_BIGNA Putative uncharacterized protein OS=Bigelowiella natans
Align length 76
Score (bit) 34.3
E-value 3.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917167|Adiantum capillus-veneris mRNA, clone:
YMU001_000097_B05.
(489 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q3LWD7|Q3LWD7_BIGNA Putative uncharacterized protein OS=Bigel... 34 3.2
tr|Q7YYI3|Q7YYI3_CRYPV Putative uncharacterized protein OS=Crypt... 33 7.2
tr|Q5CX84|Q5CX84_CRYPV Putative uncharacterized protein OS=Crypt... 33 7.2

>tr|Q3LWD7|Q3LWD7_BIGNA Putative uncharacterized protein
OS=Bigelowiella natans PE=4 SV=1
Length = 500

Score = 34.3 bits (77), Expect = 3.2
Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 4/76 (5%)
Frame = +1

Query: 226 TNSREL*QSSFFSRKS*IF----LTIANFLLFEKITNFLNYNSVKKLNLPQMAMSHC*KV 393
TN + + ++ FFS+ + I+ LLF+K +N +N+ K N P + +
Sbjct: 194 TNIKNIFRNVFFSKYKNWYSHNSFFISKGLLFQKYSNHINFKRTSKSN-PSIIII---PT 249

Query: 394 ALINRHDTKVKDTQVK 441
+LIN+ D+K KD+ +K
Sbjct: 250 SLINKKDSKFKDSSIK 265


>tr|Q7YYI3|Q7YYI3_CRYPV Putative uncharacterized protein
OS=Cryptosporidium parvum GN=1MB.209 PE=4 SV=1
Length = 1412

Score = 33.1 bits (74), Expect = 7.2
Identities = 15/38 (39%), Positives = 27/38 (71%)
Frame = -2

Query: 299 KFAIVKKIHDFLEKKELCYNSLEFVVACYDFNEELENQ 186
KFA+ +I+ LEKK++ SLE+ + YD +++LE++
Sbjct: 1197 KFAVKNRINFSLEKKQIILISLEYRIWKYDIHKQLESK 1234


>tr|Q5CX84|Q5CX84_CRYPV Putative uncharacterized protein
OS=Cryptosporidium parvum Iowa II GN=cgd6_2100 PE=4 SV=1
Length = 1645

Score = 33.1 bits (74), Expect = 7.2
Identities = 15/38 (39%), Positives = 27/38 (71%)
Frame = -2

Query: 299 KFAIVKKIHDFLEKKELCYNSLEFVVACYDFNEELENQ 186
KFA+ +I+ LEKK++ SLE+ + YD +++LE++
Sbjct: 1304 KFAVKNRINFSLEKKQIILISLEYRIWKYDIHKQLESK 1341