BP917185
Clone id YMU001_000097_D04
Library
Length 517
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000097_D04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCTAGTAATAATTTTCACTATCAACAAAGAATGTTTTTCATGCAGTACGTTTGAATACAA
ATAATTCAGGTAGCCACAATTATGTTGGCAAATAGATATTTCAAAAGAAACGAATAGGGA
CCCTATGCAAGAAGTCCATCTTAAAAGCATCTACGAGCTGCCCATCAACAAGCTGACCAA
TTCTTGTGTGTACTTATGAGGGCAGATAGTAAACCACAACTAGGAAGGATAAGAGGGTTT
GATAGAAAGCCCTTCCCATCTCGAATGTCACTCAAAGCGAGAAGAGCATCTGCAGCGTCC
TGTATAAGTGACAATGTCTTTAATGCACGTTTTTGTCGTACCTCTGCAAGTGCTGTGGCT
GCTCTGAGGTATGACTCCACATCGTCCTTGTCTTTGCCATCACTAAGGACCACCAAAAGC
TCTAACTCTTTCGCTAGCATGGCCTGCACTTGCAAGCTTTTCAGGGTGACACTTCCAAAA
TAACCTATAAACTCGGCCCATGCACTTAGAAGCTGTA
■■Homology search results ■■ -
sp_hit_id Q9FZF1
Definition sp|Q9FZF1|PX11A_ARATH Peroxisomal membrane protein 11A OS=Arabidopsis thaliana
Align length 125
Score (bit) 64.7
E-value 2.0e-10
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917185|Adiantum capillus-veneris mRNA, clone:
YMU001_000097_D04.
(517 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FZF1|PX11A_ARATH Peroxisomal membrane protein 11A OS=Arabid... 65 2e-10
sp|Q10MN2|PX113_ORYSJ Peroxisomal membrane protein 11-3 OS=Oryza... 63 9e-10
sp|A2XFQ8|PX113_ORYSI Peroxisomal membrane protein 11-3 OS=Oryza... 63 9e-10
sp|Q10MN3|PX112_ORYSJ Peroxisomal membrane protein 11-2 OS=Oryza... 46 1e-04
sp|O20159|YCX7_CHLVU Uncharacterized 79.7 kDa protein in psaB-yc... 30 5.1

>sp|Q9FZF1|PX11A_ARATH Peroxisomal membrane protein 11A
OS=Arabidopsis thaliana GN=PEX11A PE=1 SV=1
Length = 248

Score = 64.7 bits (156), Expect = 2e-10
Identities = 40/125 (32%), Positives = 63/125 (50%), Gaps = 9/125 (7%)
Frame = -3

Query: 515 QLLSAWAEFIGYFGSVTLKSLQVQAM------LAKELELLV---VLSDGKDKDDVESYLR 363
Q +SAWAE +GY GSV++K ++ + +A +E+ V + DG+D+
Sbjct: 135 QKISAWAELVGYVGSVSIKIRDLRKLNDEESCVASTIEISVSRGLACDGEDEK------- 187

Query: 362 AATALAEVRQKRALKTXXXXXXXXXXXXXXXXXXDGKGFLSNPLILPSCGLLSALISTHK 183
+ +++K+ LK DGKG LS P ++ S GL SA++STHK
Sbjct: 188 ----MKMIKEKKTLKVLSILQDLADGLMTIADIRDGKGVLSAPNVISSAGLFSAIVSTHK 243

Query: 182 NWSAC 168
NW +C
Sbjct: 244 NWISC 248


>sp|Q10MN2|PX113_ORYSJ Peroxisomal membrane protein 11-3 OS=Oryza
sativa subsp. japonica GN=PEX11-3 PE=2 SV=1
Length = 242

Score = 62.8 bits (151), Expect = 9e-10
Identities = 42/117 (35%), Positives = 59/117 (50%), Gaps = 1/117 (0%)
Frame = -3

Query: 515 QLLSAWAEFIGYFGSVTLKSLQVQAMLAKELELLVVLSDG-KDKDDVESYLRAATALAEV 339
Q LSAWAE +GY GS+T+K ++ + E + + L +G +++ DV LR
Sbjct: 138 QRLSAWAELLGYVGSITIKLEEIGKL---ESSVKMRLKEGCREESDVVRTLRV------- 187

Query: 338 RQKRALKTXXXXXXXXXXXXXXXXXXDGKGFLSNPLILPSCGLLSALISTHKNWSAC 168
K LK DGKG L + ++ S GLLSALIS HKNW++C
Sbjct: 188 --KLLLKRMSVVQDVADAVMALGDVTDGKGLLGSSTLMASAGLLSALISAHKNWNSC 242


>sp|A2XFQ8|PX113_ORYSI Peroxisomal membrane protein 11-3 OS=Oryza
sativa subsp. indica GN=PEX11-3 PE=2 SV=1
Length = 242

Score = 62.8 bits (151), Expect = 9e-10
Identities = 42/117 (35%), Positives = 59/117 (50%), Gaps = 1/117 (0%)
Frame = -3

Query: 515 QLLSAWAEFIGYFGSVTLKSLQVQAMLAKELELLVVLSDG-KDKDDVESYLRAATALAEV 339
Q LSAWAE +GY GS+T+K ++ + E + + L +G +++ DV LR
Sbjct: 138 QRLSAWAELLGYVGSITIKLEEIGKL---ESSVKMRLKEGCREESDVVRTLRV------- 187

Query: 338 RQKRALKTXXXXXXXXXXXXXXXXXXDGKGFLSNPLILPSCGLLSALISTHKNWSAC 168
K LK DGKG L + ++ S GLLSALIS HKNW++C
Sbjct: 188 --KLLLKRMSVVQDVADAVMALGDVTDGKGLLGSSTLMASAGLLSALISAHKNWNSC 242


>sp|Q10MN3|PX112_ORYSJ Peroxisomal membrane protein 11-2 OS=Oryza
sativa subsp. japonica GN=PEX11-2 PE=2 SV=1
Length = 254

Score = 45.8 bits (107), Expect = 1e-04
Identities = 32/114 (28%), Positives = 50/114 (43%)
Frame = -3

Query: 509 LSAWAEFIGYFGSVTLKSLQVQAMLAKELELLVVLSDGKDKDDVESYLRAATALAEVRQK 330
+ WA+ + + GS+ +K L+ A L +E + G++ + V + R K
Sbjct: 152 IGVWAQLLAHVGSIAIK-LEEVAELECGVEARLEEGCGEESEVVRTLSR----------K 200

Query: 329 RALKTXXXXXXXXXXXXXXXXXXDGKGFLSNPLILPSCGLLSALISTHKNWSAC 168
LK KG L + ++ S GLLSALIS HKNW++C
Sbjct: 201 LLLKLMSLVQDMVDSAMTVGDVTGRKGLLGSSTLMASAGLLSALISVHKNWNSC 254


>sp|O20159|YCX7_CHLVU Uncharacterized 79.7 kDa protein in psaB-ycf62
intergenic region OS=Chlorella vulgaris PE=4 SV=1
Length = 695

Score = 30.4 bits (67), Expect = 5.1
Identities = 15/59 (25%), Positives = 31/59 (52%)
Frame = -3

Query: 509 LSAWAEFIGYFGSVTLKSLQVQAMLAKELELLVVLSDGKDKDDVESYLRAATALAEVRQ 333
+S E GY +V L + + +L++ L+ L++ S D+ SY++ +L ++Q
Sbjct: 501 ISCLYEMGGYIANVELTTGAILKLLSQSLDSLLLSSSNSSVDERNSYVKTKASLQSLKQ 559


tr_hit_id A9NLT4
Definition tr|A9NLT4|A9NLT4_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 115
Score (bit) 79.7
E-value 8.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917185|Adiantum capillus-veneris mRNA, clone:
YMU001_000097_D04.
(517 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NLT4|A9NLT4_PICSI Putative uncharacterized protein OS=Picea... 80 8e-14
tr|A9SJG7|A9SJG7_PHYPA Predicted protein OS=Physcomitrella paten... 76 1e-12
tr|A7NTH2|A7NTH2_VITVI Chromosome chr18 scaffold_1, whole genome... 74 4e-12
tr|A7NTH5|A7NTH5_VITVI Chromosome chr18 scaffold_1, whole genome... 67 5e-10
tr|B6TV18|B6TV18_MAIZE Peroxisomal biogenesis factor 11 family p... 62 2e-08
tr|A3AH37|A3AH37_ORYSJ Putative uncharacterized protein OS=Oryza... 46 0.001
tr|Q8Q0U8|Q8Q0U8_METMA Putative uncharacterized protein OS=Metha... 33 6.5
tr|Q9XAJ1|Q9XAJ1_STRCO Putative membrane protein OS=Streptomyces... 33 8.3

>tr|A9NLT4|A9NLT4_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 275

Score = 79.7 bits (195), Expect = 8e-14
Identities = 45/115 (39%), Positives = 63/115 (54%)
Frame = -3

Query: 515 QLLSAWAEFIGYFGSVTLKSLQVQAMLAKELELLVVLSDGKDKDDVESYLRAATALAEVR 336
Q+LSAW E IGY GS+ K LQ+ A+ K+ L +S + + + A ++++R
Sbjct: 162 QMLSAWTELIGYCGSIAAKGLQISALRKKQSVLASKISGVTGEAQISD--KYAAEISQLR 219

Query: 335 QKRALKTXXXXXXXXXXXXXXXXXXDGKGFLSNPLILPSCGLLSALISTHKNWSA 171
+K+ LK +GKG LSNPL+L S GLLSALIS KNWS+
Sbjct: 220 EKQVLKVVSIIQDFADGLLALADIRNGKGTLSNPLLLASAGLLSALISAQKNWSS 274


>tr|A9SJG7|A9SJG7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_80254 PE=4 SV=1
Length = 240

Score = 75.9 bits (185), Expect = 1e-12
Identities = 47/114 (41%), Positives = 59/114 (51%)
Frame = -3

Query: 509 LSAWAEFIGYFGSVTLKSLQVQAMLAKELELLVVLSDGKDKDDVESYLRAATALAEVRQK 330
+SAWAEFIGYFGSV LKS+QV L +E +LL + K + S + L ++ K
Sbjct: 129 ISAWAEFIGYFGSVALKSIQVSIYLEQEAKLLQGMR--KKAEGGISPVSEIKELQALQGK 186

Query: 329 RALKTXXXXXXXXXXXXXXXXXXDGKGFLSNPLILPSCGLLSALISTHKNWSAC 168
R +KT + KG L NP +L GLLSALIS KNW C
Sbjct: 187 RLMKTLSIIQDLADSLLALTDIRETKGVLDNPFLLAFAGLLSALISAQKNWKNC 240


>tr|A7NTH2|A7NTH2_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00014666001
PE=4 SV=1
Length = 260

Score = 73.9 bits (180), Expect = 4e-12
Identities = 43/116 (37%), Positives = 61/116 (52%)
Frame = -3

Query: 515 QLLSAWAEFIGYFGSVTLKSLQVQAMLAKELELLVVLSDGKDKDDVESYLRAATALAEVR 336
Q +SAWAEF+GY GS++LK ++ + E LL + + Y A + +++
Sbjct: 147 QKISAWAEFVGYIGSISLKIRDLKRINEDESRLLSTIEISISRG--LKYDEEAKKIQKMK 204

Query: 335 QKRALKTXXXXXXXXXXXXXXXXXXDGKGFLSNPLILPSCGLLSALISTHKNWSAC 168
+KR +K DGKG LS PL++ S GLLSALIS HKNW +C
Sbjct: 205 EKRLMKRLSIVQDLADGLMALADIRDGKGRLSGPLLMSSAGLLSALISAHKNWLSC 260


>tr|A7NTH5|A7NTH5_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00014669001
PE=4 SV=1
Length = 260

Score = 67.0 bits (162), Expect = 5e-10
Identities = 40/116 (34%), Positives = 59/116 (50%)
Frame = -3

Query: 515 QLLSAWAEFIGYFGSVTLKSLQVQAMLAKELELLVVLSDGKDKDDVESYLRAATALAEVR 336
Q +SAWA F+G+ GS++LK ++ + E LL + + Y A + +++
Sbjct: 147 QKISAWAGFVGHIGSISLKIRDLKRINEDESRLLSTIEISISRG--LKYDEEAKKIHKLK 204

Query: 335 QKRALKTXXXXXXXXXXXXXXXXXXDGKGFLSNPLILPSCGLLSALISTHKNWSAC 168
+KR +K DGKG LS PL++ S GLLSAL S HKNW +C
Sbjct: 205 EKRLMKRLSIVQDLADGLMALADIRDGKGRLSGPLLMSSAGLLSALTSAHKNWLSC 260


>tr|B6TV18|B6TV18_MAIZE Peroxisomal biogenesis factor 11 family
protein OS=Zea mays PE=2 SV=1
Length = 242

Score = 61.6 bits (148), Expect = 2e-08
Identities = 41/116 (35%), Positives = 59/116 (50%)
Frame = -3

Query: 515 QLLSAWAEFIGYFGSVTLKSLQVQAMLAKELELLVVLSDGKDKDDVESYLRAATALAEVR 336
Q LSAWAE +GY GS+ +K +V + + + LV KD D + + A+ ++
Sbjct: 138 QRLSAWAELLGYVGSILIKLEEVAKIESSIKKRLV-----KDCD------KESEAVKTMQ 186

Query: 335 QKRALKTXXXXXXXXXXXXXXXXXXDGKGFLSNPLILPSCGLLSALISTHKNWSAC 168
K LK DGKG L + ++ + GLLSALISTHKNW++C
Sbjct: 187 GKLLLKRMSVVQDVADAVMALGDVTDGKGLLGSSTLMAAAGLLSALISTHKNWNSC 242


>tr|A3AH37|A3AH37_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_010109 PE=4 SV=1
Length = 328

Score = 45.8 bits (107), Expect = 0.001
Identities = 32/114 (28%), Positives = 50/114 (43%)
Frame = -3

Query: 509 LSAWAEFIGYFGSVTLKSLQVQAMLAKELELLVVLSDGKDKDDVESYLRAATALAEVRQK 330
+ WA+ + + GS+ +K L+ A L +E + G++ + V + R K
Sbjct: 226 IGVWAQLLAHVGSIAIK-LEEVAELECGVEARLEEGCGEESEVVRTLSR----------K 274

Query: 329 RALKTXXXXXXXXXXXXXXXXXXDGKGFLSNPLILPSCGLLSALISTHKNWSAC 168
LK KG L + ++ S GLLSALIS HKNW++C
Sbjct: 275 LLLKLMSLVQDMVDSAMTVGDVTGRKGLLGSSTLMASAGLLSALISVHKNWNSC 328


>tr|Q8Q0U8|Q8Q0U8_METMA Putative uncharacterized protein
OS=Methanosarcina mazei GN=MM_0034 PE=4 SV=1
Length = 314

Score = 33.5 bits (75), Expect = 6.5
Identities = 27/100 (27%), Positives = 45/100 (45%), Gaps = 9/100 (9%)
Frame = -1

Query: 355 QHLQRYDKNVH*RHCHLYRTLQMLFSL*VTFEMGRAFYQTLLSFLVVVYYL-----PS*V 191
+ L Y +N H ++ HL L++ + E F+ L+ FL+++YYL PS
Sbjct: 206 KRLTSYYENYHLKNEHLTWKLKIFRAPLPVIERIEGFFNVLIFFLLIIYYLSTVFTPSTT 265

Query: 190 HTRIGQ---LVDGQLVDAFKMD-FLHRVPIRFF*NIYLPT 83
+ I Q ++ + F D L P +FF Y+ T
Sbjct: 266 YENITQFISIITASIFVTFIFDLLLFNQPYKFFYKKYINT 305


>tr|Q9XAJ1|Q9XAJ1_STRCO Putative membrane protein OS=Streptomyces
coelicolor GN=SCO3611 PE=4 SV=1
Length = 278

Score = 33.1 bits (74), Expect = 8.3
Identities = 15/42 (35%), Positives = 25/42 (59%)
Frame = -3

Query: 500 WAEFIGYFGSVTLKSLQVQAMLAKELELLVVLSDGKDKDDVE 375
W F+G+ + + L+ + LA++ EL +V DGKD +D E
Sbjct: 224 WFAFVGFVIFMWFRLLRREVELARDAELGLVAEDGKDGEDTE 265