BP917200
Clone id YMU001_000097_E09
Library
Length 543
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000097_E09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGAGTTGGATGAGGAGCTAGATGAGCATCTGGACCTCTCTTCTCTACGAGCACATCCTCT
AAAGCCTGTGCAGCATTAATGAGTTCATGGAGTGGACTTTAGGGTTTTCAGGTTTTTCTG
GTCTTACGGCCAATGGGCACTCTCTTGCTTTCAACCTTAACTTGTCTCCAACGAAAGGTT
ACAACTTTACTAGCACCGACATCATGACACCAGACGTAGATTGGGAGACTTCTAAGTGCA
GCAATGGGTCGCCTTTCTACAATGCAAGTGGGCGGGAGTATCTTTATGGGAAGCTTTAAC
AATTGAGGGTGTATGAATTAGCTTGCCCTATCGACTACAGTTAAAACTGTTTTGCGTCAT
ATTTTATACACAAATTTTGGACTTGATACCCCACATGGTTTCTGGCCAACAATGGGCATT
TTCTTTTATGCAACCATGTTCAAAGGTTCTAAGCCCTACACTCCTTTTGCTCACAATTAC
AAGAAGTATGATGGGCCATCATACACTTGCTGTTATATGAATCATGGTTTGATTTTGACC
AAA
■■Homology search results ■■ -
sp_hit_id Q99PP2
Definition sp|Q99PP2|ZN318_MOUSE Zinc finger protein 318 (Fragment) OS=Mus musculus
Align length 64
Score (bit) 30.8
E-value 4.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917200|Adiantum capillus-veneris mRNA, clone:
YMU001_000097_E09.
(543 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q99PP2|ZN318_MOUSE Zinc finger protein 318 (Fragment) OS=Mus ... 31 4.5
sp|B1ML30|Y4606_MYCA9 Putative S-adenosyl-L-methionine-dependent... 30 5.8
sp|Q5RE63|UBP18_PONAB Ubl carboxyl-terminal hydrolase 18 OS=Pong... 30 9.9
sp|Q9UMW8|UBP18_HUMAN Ubl carboxyl-terminal hydrolase 18 OS=Homo... 30 9.9
sp|Q812E4|SYTL5_RAT Synaptotagmin-like protein 5 OS=Rattus norve... 30 9.9

>sp|Q99PP2|ZN318_MOUSE Zinc finger protein 318 (Fragment) OS=Mus
musculus GN=Znf318 PE=1 SV=2
Length = 2064

Score = 30.8 bits (68), Expect = 4.5
Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 1/64 (1%)
Frame = +3

Query: 72 SINEFMEWTLGFSGFSGLTANGHSLAFNLNLSPTKGYNFTSTDIMTPDVDW-ETSKCSNG 248
S+ E + T+G F T L+ L +SP G D +T D D+ +S+CS G
Sbjct: 1 SLEESLRITVGNDHFCVSTPERRRLSDRLGISPVDGLQDMDRDDLTDDSDFTRSSQCSRG 60

Query: 249 SPFY 260
Y
Sbjct: 61 LERY 64


>sp|B1ML30|Y4606_MYCA9 Putative S-adenosyl-L-methionine-dependent
methyltransferase MAB_4606c OS=Mycobacterium abscessus
(strain ATCC 19977 / DSM 44196) GN=MAB_4606c PE=3 SV=1
Length = 316

Score = 30.4 bits (67), Expect = 5.8
Identities = 29/93 (31%), Positives = 41/93 (44%), Gaps = 2/93 (2%)
Frame = +2

Query: 89 GVDFRVFRFFWSYGQWALSCFQP*LVSNERLQLY*H--RHHDTRRRLGDF*VQQWVAFLQ 262
G+D R +R W G QP ++ +R L H R RR + Q W A LQ
Sbjct: 117 GLDSRAYRLDWPAGTTVYEIDQPLVLQYKRHTLDAHDVRSACLRREVPVDLRQDWPAALQ 176

Query: 263 CKWAGVSLWEALTIEGV*ISLPYRLQLKLFCVI 361
+ V+ A EG+ + LP Q +LF +I
Sbjct: 177 REGFDVAEPTAWLAEGLLMYLPTEAQDRLFELI 209


>sp|Q5RE63|UBP18_PONAB Ubl carboxyl-terminal hydrolase 18 OS=Pongo
abelii GN=USP18 PE=2 SV=1
Length = 375

Score = 29.6 bits (65), Expect = 9.9
Identities = 16/55 (29%), Positives = 26/55 (47%)
Frame = +3

Query: 120 GLTANGHSLAFNLNLSPTKGYNFTSTDIMTPDVDWETSKCSNGSPFYNASGREYL 284
G+ +GH + N K + F ++I V WE +C+ G+P Y+ YL
Sbjct: 315 GMADSGHYCVYIRNAVDGKWFCFNDSNICL--VSWEDIQCTYGNPNYHWQETAYL 367


>sp|Q9UMW8|UBP18_HUMAN Ubl carboxyl-terminal hydrolase 18 OS=Homo
sapiens GN=USP18 PE=1 SV=1
Length = 372

Score = 29.6 bits (65), Expect = 9.9
Identities = 16/55 (29%), Positives = 26/55 (47%)
Frame = +3

Query: 120 GLTANGHSLAFNLNLSPTKGYNFTSTDIMTPDVDWETSKCSNGSPFYNASGREYL 284
G+ +GH + N K + F ++I V WE +C+ G+P Y+ YL
Sbjct: 312 GMADSGHYCVYIRNAVDGKWFCFNDSNICL--VSWEDIQCTYGNPNYHWQETAYL 364


>sp|Q812E4|SYTL5_RAT Synaptotagmin-like protein 5 OS=Rattus
norvegicus GN=Sytl5 PE=2 SV=1
Length = 753

Score = 29.6 bits (65), Expect = 9.9
Identities = 16/52 (30%), Positives = 27/52 (51%)
Frame = +3

Query: 117 SGLTANGHSLAFNLNLSPTKGYNFTSTDIMTPDVDWETSKCSNGSPFYNASG 272
S +AN HSLA L+ S G + + + PD D +T+ ++ Y+ +G
Sbjct: 371 SRFSANTHSLASGLSTSSQAGSDRKRSYLHVPDADSDTTSLNSMMSVYSETG 422


tr_hit_id A8WQ96
Definition tr|A8WQ96|A8WQ96_CAEBR Putative uncharacterized protein OS=Caenorhabditis briggsae
Align length 64
Score (bit) 35.8
E-value 1.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917200|Adiantum capillus-veneris mRNA, clone:
YMU001_000097_E09.
(543 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8WQ96|A8WQ96_CAEBR Putative uncharacterized protein OS=Caeno... 36 1.5
tr|Q4QJ27|Q4QJ27_LEIMA Putative uncharacterized protein OS=Leish... 35 3.3
tr|Q97TF4|Q97TF4_CLOAB Stage V sporulation protein D, penicillin... 34 4.4
tr|A4HSU3|A4HSU3_LEIIN Putative uncharacterized protein OS=Leish... 33 7.4
tr|Q97M69|Q97M69_CLOAB Sporulation specific penicillin-binding p... 33 9.7

>tr|A8WQ96|A8WQ96_CAEBR Putative uncharacterized protein
OS=Caenorhabditis briggsae GN=CBG01376 PE=4 SV=2
Length = 814

Score = 35.8 bits (81), Expect = 1.5
Identities = 22/64 (34%), Positives = 29/64 (45%)
Frame = +3

Query: 87 MEWTLGFSGFSGLTANGHSLAFNLNLSPTKGYNFTSTDIMTPDVDWETSKCSNGSPFYNA 266
M W F GF GLT G L N + YNF ++ P +++ TSK N S F
Sbjct: 1 MHWLRWFLGFLGLTCVGGKLGLEFNETSDNPYNFPWSE-NVPKLEFTTSKPRNMSDFVKE 59

Query: 267 SGRE 278
R+
Sbjct: 60 EVRK 63


>tr|Q4QJ27|Q4QJ27_LEIMA Putative uncharacterized protein
OS=Leishmania major GN=LmjF06.0510 PE=4 SV=1
Length = 659

Score = 34.7 bits (78), Expect = 3.3
Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
Frame = -2

Query: 248 PIAALRSLPIYVWCHDVGASKVVTFRWRQVKVESKRVPIGRKTRKT*KP*SPLHELINAA 69
P A+L+ LP+Y+ VGA + +R R + ++RVP+ RK K P P +
Sbjct: 460 PAASLQLLPVYIANFAVGAGVGLVWRRRHLLTAARRVPLLRKVVKLLFPLPP--PPLRLP 517

Query: 68 QALEDVLVEKRGPDAH-LAPHP 6
+AL+++ P+ H L HP
Sbjct: 518 EALQEL-----SPECHVLLVHP 534


>tr|Q97TF4|Q97TF4_CLOAB Stage V sporulation protein D,
penicillin-binding protein OS=Clostridium acetobutylicum
GN=spoVD PE=4 SV=1
Length = 601

Score = 34.3 bits (77), Expect = 4.4
Identities = 17/53 (32%), Positives = 27/53 (50%)
Frame = +3

Query: 78 NEFMEWTLGFSGFSGLTANGHSLAFNLNLSPTKGYNFTSTDIMTPDVDWETSK 236
N F+ LG+ G A+G L++N LS T G+ TD+M + + S+
Sbjct: 171 NNFLSSVLGYLNSDGNGASGVELSYNKILSGTPGHKIVETDVMRNQLPYGNSE 223


>tr|A4HSU3|A4HSU3_LEIIN Putative uncharacterized protein
OS=Leishmania infantum GN=LinJ06.0530 PE=4 SV=1
Length = 679

Score = 33.5 bits (75), Expect = 7.4
Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
Frame = -2

Query: 248 PIAALRSLPIYVWCHDVGASKVVTFRWRQVKVESKRVPIGRKTRKT*KP*SPLHELINAA 69
P A+L+ LP+Y+ VGA + +R R + ++RVP+ R+ K P P +
Sbjct: 460 PAASLQLLPVYIANFAVGAGVGLVWRRRHLLAAARRVPLLRRVVKLLFPLPP--PPLRLP 517

Query: 68 QALEDVLVEKRGPDAH-LAPHP 6
+AL+++ P+ H L HP
Sbjct: 518 EALQEL-----SPECHVLLVHP 534


>tr|Q97M69|Q97M69_CLOAB Sporulation specific penicillin-binding
protein OS=Clostridium acetobutylicum GN=spoVD PE=4 SV=1
Length = 605

Score = 33.1 bits (74), Expect = 9.7
Identities = 16/53 (30%), Positives = 26/53 (49%)
Frame = +3

Query: 78 NEFMEWTLGFSGFSGLTANGHSLAFNLNLSPTKGYNFTSTDIMTPDVDWETSK 236
N F+ LG++ G A+G L++N L+ GY TD+ + + T K
Sbjct: 171 NNFLSSVLGYTRSDGSGASGVELSYNKTLAGIPGYKSVETDVTRKQLPYGTYK 223