BP917210
Clone id YMU001_000097_F10
Library
Length 553
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000097_F10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CGAGGTAGTAATTATCCCAGTGGTAATGCCAACTATGCTCAGGGGAACTCATATTCTAAT
GTTAGTGGAGGGAGAGGTCCAAATGCGAGCGGAACAGGTCGTGCGCAGCAATATGGGACG
TCGCACCCTCAGGGCATGCCCCAGCCTGCAGGTGCTTATAATGGTCAGCCATATATGACA
GATCAAGCTGGCCAGTATAGTGATATGGATAGTGGTGTTTATTCTCGAGCTGGGGCTTCA
CACGGCTATCAGATGCCTCCTGGGTCTCCTCCGCATAGGCAGGACTACAGGCAGCAGCAA
CGGTGAAATCTTAGCATGCAAGGTGACTGTCTTTGGCAGAACTTGCAATGGCTTTCACCA
GATGGCAATCACAAACTGGTGGTTCGGAGCTTTTGGGCGAGAGGCATTATGCTCATACAA
GATCATCACCATGTAAACAGAGAGAACAAGCAAGCAAACATGTGCAGATTATTTATGTAA
CACTATCGAAAGTGAATATTAAAAGTGCAAATTCTACAGATAGTACTGCTGTCTACTGGA
AAAGCTTGGATAA
■■Homology search results ■■ -
sp_hit_id Q86YZ3
Definition sp|Q86YZ3|HORN_HUMAN Hornerin OS=Homo sapiens
Align length 99
Score (bit) 43.1
E-value 0.001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917210|Adiantum capillus-veneris mRNA, clone:
YMU001_000097_F10.
(553 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q86YZ3|HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 43 0.001
sp|Q92125|ANXA7_XENLA Annexin A7 OS=Xenopus laevis GN=anxa7 PE=2... 38 0.038
sp|Q5JK68|CDKC2_ORYSJ Cyclin-dependent kinase C-2 OS=Oryza sativ... 37 0.065
sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila ... 37 0.084
sp|A6R3L3|DED1_AJECN ATP-dependent RNA helicase DED1 OS=Ajellomy... 36 0.11
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic ... 36 0.14
sp|Q12906|ILF3_HUMAN Interleukin enhancer-binding factor 3 OS=Ho... 36 0.14
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens ... 36 0.14
sp|P35085|CBPP_DICDI Calcium-binding protein P OS=Dictyostelium ... 36 0.14
sp|O35126|ATN1_MOUSE Atrophin-1 OS=Mus musculus GN=Atn1 PE=1 SV=1 36 0.14
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus ... 35 0.19
sp|A3C5A7|GRP2_ORYSJ Glycine-rich cell wall structural protein 2... 35 0.25
sp|P0C5C7|GRP2_ORYSI Glycine-rich cell wall structural protein 2... 35 0.25
sp|Q6CVS3|LGE1_KLULA Transcriptional regulatory protein LGE1 OS=... 35 0.32
sp|Q6DC93|PEF1_DANRE Peflin OS=Danio rerio GN=pef1 PE=2 SV=1 34 0.42
sp|Q5D862|FILA2_HUMAN Filaggrin-2 OS=Homo sapiens GN=FLG2 PE=1 SV=1 34 0.42
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus... 34 0.42
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norve... 34 0.55
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus muscul... 34 0.55
sp|P13852|PRIO_RAT Major prion protein OS=Rattus norvegicus GN=P... 34 0.55
sp|Q2VIS4|FILA2_MOUSE Filaggrin-2 OS=Mus musculus GN=Flg2 PE=2 SV=2 34 0.55
sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Scleroti... 34 0.55
sp|P78358|CTG1B_HUMAN Cancer/testis antigen 1 OS=Homo sapiens GN... 34 0.55
sp|P54258|ATN1_RAT Atrophin-1 OS=Rattus norvegicus GN=Atn1 PE=2 ... 34 0.55
sp|Q6NXA4|ILF3_DANRE Interleukin enhancer-binding factor 3 homol... 33 0.71
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegi... 33 0.71
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus... 33 0.71
sp|P34545|CBP1_CAEEL Protein cbp-1 OS=Caenorhabditis elegans GN=... 33 0.71
sp|Q5ANA8|MCA1_CANAL Metacaspase-1 OS=Candida albicans GN=MCA1 P... 33 0.93
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 ... 33 0.93

>sp|Q86YZ3|HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2
Length = 2850

Score = 43.1 bits (100), Expect = 0.001
Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 3/99 (3%)
Frame = +1

Query: 7 SNYPSGNANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQ 186
++Y +++Y + NS S+ S GRG SG+G++ YG G+ +GQ D
Sbjct: 170 NSYSGQSSSYGEQNSDSHQSSGRGQCGSGSGQSPNYGQH---------GSGSGQSSSNDT 220

Query: 187 AGQYSDMDSGV---YSRAGASHGYQMPPGSPPHRQDYRQ 294
G S SG S +G S GY H Y Q
Sbjct: 221 HGSGSGQSSGFSQHKSSSGQSSGYSQHGSGSGHSSGYGQ 259



Score = 36.6 bits (83), Expect = 0.084
Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 6/96 (6%)
Frame = +1

Query: 25 NANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPA----GAYNGQPYMTDQAG 192
+++Y Q S S+ + GRG + SG+G++ +G P+ G+ +G+ + + G
Sbjct: 864 SSSYGQHESASHHASGRGRHGSGSGQSPGHGQRGSGSGQSPSYGRHGSGSGRSSSSGRHG 923

Query: 193 QYSDMDSGV--YSRAGASHGYQMPPGSPPHRQDYRQ 294
S SG S +G S GY H Y Q
Sbjct: 924 SGSGQSSGFGHKSSSGQSSGYTQHGSGSGHSSSYEQ 959



Score = 35.0 bits (79), Expect = 0.25
Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
Frame = +1

Query: 25 NANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQYSD 204
+++Y Q S S S GRG ++SG+G++ +G P+ +G G
Sbjct: 397 SSSYGQHESASRHSSGRGQHSSGSGQSPGHGQRGSGSGQSPSSGQHG-------TGFGRS 449

Query: 205 MDSGVY-SRAGASHGYQMPPGSPPHRQDYRQ 294
SG Y S +G S G+ S H Y Q
Sbjct: 450 SSSGPYVSGSGYSSGFGHHESSSEHSSGYTQ 480



Score = 33.9 bits (76), Expect = 0.55
Identities = 31/100 (31%), Positives = 44/100 (44%)
Frame = +1

Query: 4 GSNYPSGNANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTD 183
GS+ SG + G+ S G G SG+G++ YG H G Q +G Y+ +
Sbjct: 2752 GSSQSSGYGRHGAGSGQSLSHGRHG---SGSGQSSSYG-QHGSGSGQSSG-YSQHGSGSG 2806

Query: 184 QAGQYSDMDSGVYSRAGASHGYQMPPGSPPHRQDYRQQQR 303
Q G YS G G+S Y + S +Y Q+QR
Sbjct: 2807 QDG-YSYCKGGSNHDGGSSGSYFLSFPSSTSPYEYVQEQR 2845



Score = 31.6 bits (70), Expect = 2.7
Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 5/85 (5%)
Frame = +1

Query: 4 GSNYPSGNANYAQGNSYSNVSGGRGPNASGTGRAQQY-----GTSHPQGMPQPAGAYNGQ 168
GS + S N + S S S G G + SG+G++ Y G+SH G + G+ +GQ
Sbjct: 681 GSGWSSSNGPH---GSVSGQSSGFG-HKSGSGQSSGYSQHGSGSSHSSGY-RKHGSRSGQ 735

Query: 169 PYMTDQAGQYSDMDSGVYSRAGASH 243
++Q G S + S SH
Sbjct: 736 SSRSEQHGSSSGLSSSYGQHGSGSH 760



Score = 31.6 bits (70), Expect = 2.7
Identities = 26/95 (27%), Positives = 37/95 (38%), Gaps = 3/95 (3%)
Frame = +1

Query: 19 SGNANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQY 198
S +++Y Q S S S RG + SG+G + YG G+ +G + + G
Sbjct: 1814 SQSSSYGQQGSGSGQSPSRGRHGSGSGHSSSYGQH---------GSGSGWSSSSGRHGSG 1864

Query: 199 SDMDSGV---YSRAGASHGYQMPPGSPPHRQDYRQ 294
S SG S + S GY H Y Q
Sbjct: 1865 SGQSSGFGHHESSSWQSSGYTQHGSGSGHSSSYEQ 1899



Score = 31.6 bits (70), Expect = 2.7
Identities = 26/95 (27%), Positives = 37/95 (38%), Gaps = 3/95 (3%)
Frame = +1

Query: 19 SGNANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQY 198
S +++Y Q S S S RG + SG+G + YG G+ +G + + G
Sbjct: 2284 SQSSSYGQQGSGSGQSPSRGRHGSGSGHSSSYGQH---------GSGSGWSSSSGRHGSG 2334

Query: 199 SDMDSGV---YSRAGASHGYQMPPGSPPHRQDYRQ 294
S SG S + S GY H Y Q
Sbjct: 2335 SGQSSGFGHHESSSWQSSGYTQHGSGSGHSSSYEQ 2369



Score = 30.8 bits (68), Expect = 4.6
Identities = 26/94 (27%), Positives = 34/94 (36%), Gaps = 2/94 (2%)
Frame = +1

Query: 19 SGNANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQY 198
S ++ Y Q S S S RG + S G + YG G+ +G G
Sbjct: 644 SQSSRYGQQGSGSGQSPSRGRHGSDFGHSSSYGQH---------GSGSGWSSSNGPHGSV 694

Query: 199 SDMDSGV--YSRAGASHGYQMPPGSPPHRQDYRQ 294
S SG S +G S GY H YR+
Sbjct: 695 SGQSSGFGHKSGSGQSSGYSQHGSGSSHSSGYRK 728



Score = 30.8 bits (68), Expect = 4.6
Identities = 32/110 (29%), Positives = 45/110 (40%), Gaps = 12/110 (10%)
Frame = +1

Query: 1 RGSNYPSGN---ANYAQGNSYSNVSGGRGPNASGTGRAQQYGTS-HPQGMPQPA--GAYN 162
RG + S + ++Y Q S S S G G + SG+G++ H G Q + G Y
Sbjct: 1909 RGEQHGSSSGSSSSYGQHGSGSRQSLGHGQHGSGSGQSPSPSRGRHGSGSGQSSSYGPYG 1968

Query: 163 GQPYMTDQAGQY---SDMDSGV---YSRAGASHGYQMPPGSPPHRQDYRQ 294
+ G Y S SG+ SR+G S GY S H + Q
Sbjct: 1969 SGSGWSSSRGPYESGSGHSSGLGHRESRSGQSSGYGQHGSSSGHSSTHGQ 2018



Score = 30.4 bits (67), Expect = 6.0
Identities = 29/99 (29%), Positives = 41/99 (41%), Gaps = 9/99 (9%)
Frame = +1

Query: 25 NANYAQGNSYSNVSGGRGPNASGTGRAQQYGTS-HPQGMPQPA--GAYNGQPYMTDQAGQ 195
+++Y Q S S S G G + SG+G++ H G Q + G Y + G
Sbjct: 980 SSSYGQHGSGSRQSLGHGQHGSGSGQSPSPSRGRHGSGSGQSSSYGPYRSGSGWSSSRGP 1039

Query: 196 Y---SDMDSGV---YSRAGASHGYQMPPGSPPHRQDYRQ 294
Y S SG+ SR+G S GY S H + Q
Sbjct: 1040 YESGSGHSSGLGHRESRSGQSSGYGQHGSSSGHSSTHGQ 1078



Score = 30.0 bits (66), Expect = 7.9
Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 4/86 (4%)
Frame = +1

Query: 4 GSNYPSGNANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTD 183
GS+ SG Y + S S S G G SG+ ++ YG H G + + + P + +
Sbjct: 2048 GSSQSSG---YGRQGSGSGQSPGHGQRGSGSRQSPSYG-RHGSGSGRSSSSGQHGPGLGE 2103

Query: 184 QAG----QYSDMDSGVYSRAGASHGY 249
+G + S S YS+ G+ G+
Sbjct: 2104 SSGFGHHESSSGQSSSYSQHGSGSGH 2129


>sp|Q92125|ANXA7_XENLA Annexin A7 OS=Xenopus laevis GN=anxa7 PE=2
SV=1
Length = 512

Score = 37.7 bits (86), Expect = 0.038
Identities = 28/98 (28%), Positives = 34/98 (34%), Gaps = 10/98 (10%)
Frame = +1

Query: 13 YPSGNANYAQ--------GNSYSNVSGGRGPNASGTGRAQQYGTSHPQ--GMPQPAGAYN 162
YP G+ +Y G GG P ASG G A G +P G P P G
Sbjct: 15 YPGGDPSYPPAAQQAFPGGQFPPAAGGGAFPPASGGGNAPPPGGGYPHAGGYPAPGGYPG 74

Query: 163 GQPYMTDQAGQYSDMDSGVYSRAGASHGYQMPPGSPPH 276
G P G + GY PPG+P +
Sbjct: 75 GMPSYPGAPG---------FGAPAGGQGYGAPPGAPAY 103


>sp|Q5JK68|CDKC2_ORYSJ Cyclin-dependent kinase C-2 OS=Oryza sativa
subsp. japonica GN=CDKC-2 PE=2 SV=1
Length = 513

Score = 37.0 bits (84), Expect = 0.065
Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 2/40 (5%)
Frame = +1

Query: 4 GSNYPSGNANYAQGNSYSNVSGGRGP--NASGTGRAQQYG 117
GS Y G NY QG Y GRGP N G+ QQYG
Sbjct: 471 GSGYGVGGPNYQQGGPYGASGPGRGPNYNQGGSRNQQQYG 510


>sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila
melanogaster GN=mle PE=1 SV=2
Length = 1293

Score = 36.6 bits (83), Expect = 0.084
Identities = 27/86 (31%), Positives = 34/86 (39%), Gaps = 3/86 (3%)
Frame = +1

Query: 4 GSNYPSGNANYAQ-GNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAY--NGQPY 174
G Y + Y G Y N+ GG G NA G G YG ++ G G Y NG Y
Sbjct: 1202 GGGYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYG-NNGGGYRNNGGGYGNNGGGY 1260

Query: 175 MTDQAGQYSDMDSGVYSRAGASHGYQ 252
+ G +S S G +G Q
Sbjct: 1261 GNKRGGFGDSFESNRGSGGGFRNGDQ 1286


>sp|A6R3L3|DED1_AJECN ATP-dependent RNA helicase DED1 OS=Ajellomyces
capsulata (strain NAm1 / WU24) GN=DED1 PE=3 SV=1
Length = 694

Score = 36.2 bits (82), Expect = 0.11
Identities = 25/74 (33%), Positives = 32/74 (43%), Gaps = 4/74 (5%)
Frame = +1

Query: 40 QGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQ---AGQYSDMD 210
QGN Y + GGRG G GR G+S + + + G Y G + G Y D
Sbjct: 598 QGNYYGSSGGGRGGRGGGRGRG---GSSSTRDIRRTGGGYGGGGMGGSRPAYGGGYGDSG 654

Query: 211 S-GVYSRAGASHGY 249
+ G Y G S GY
Sbjct: 655 AGGPYGYGGGSGGY 668


>sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and
nuclear OS=Coccidioides immitis GN=PAB1 PE=3 SV=1
Length = 768

Score = 35.8 bits (81), Expect = 0.14
Identities = 24/69 (34%), Positives = 28/69 (40%), Gaps = 5/69 (7%)
Frame = +1

Query: 4 GSNYPSGN---ANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHP--QGMPQPAGAYNGQ 168
G NYP A + +G + G PN G G QYG P QGM +P A GQ
Sbjct: 587 GLNYPQMGQVQAPFGRGRGQAPSGQGMPPNVQGMGPGGQYGRGMPVQQGMGRPGQAGRGQ 646

Query: 169 PYMTDQAGQ 195
GQ
Sbjct: 647 GAPAQAVGQ 655


>sp|Q12906|ILF3_HUMAN Interleukin enhancer-binding factor 3 OS=Homo
sapiens GN=ILF3 PE=1 SV=3
Length = 894

Score = 35.8 bits (81), Expect = 0.14
Identities = 30/101 (29%), Positives = 39/101 (38%), Gaps = 16/101 (15%)
Frame = +1

Query: 13 YPSGNANYAQGNSYSNVSGGRGP--------NASGTG---RAQQYGTSHPQGMPQPAGAY 159
Y G +Y+ NSY++ GG G N SG+G YG+ P G Y
Sbjct: 777 YNHGQGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGY 836

Query: 160 -----NGQPYMTDQAGQYSDMDSGVYSRAGASHGYQMPPGS 267
G Y Q G YS + Y+ G+ Y PP S
Sbjct: 837 GGGSGGGSSYQGKQGG-YSQSN---YNSPGSGQNYSGPPSS 873



Score = 30.4 bits (67), Expect = 6.0
Identities = 24/80 (30%), Positives = 30/80 (37%), Gaps = 2/80 (2%)
Frame = +1

Query: 34 YAQGNSYSNVSGGRGPNASGTGRAQQY--GTSHPQGMPQPAGAYNGQPYMTDQAGQYSDM 207
Y+ G N SGG G G+ Y G ++ +P P A QP+ Q Y
Sbjct: 690 YSNGGHSGNASGGGGGGGGGSSGYGSYYQGDNYNSPVP-PKHAGKKQPHGGQQKPSYG-- 746

Query: 208 DSGVYSRAGASHGYQMPPGS 267
SG S G Y P S
Sbjct: 747 -SGYQSHQGQQQSYNQSPYS 765


>sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens
GN=COL5A2 PE=1 SV=3
Length = 1499

Score = 35.8 bits (81), Expect = 0.14
Identities = 30/85 (35%), Positives = 36/85 (42%), Gaps = 5/85 (5%)
Frame = +1

Query: 46 NSYSNVSGGRG----PNASG-TGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQYSDMD 210
N + GGRG P A+G G A + G P G P PAG G+P G D
Sbjct: 890 NGVPGLKGGRGTQGPPGATGFPGSAGRVGPPGPAGAPGPAGPL-GEPGKEGPPGLRG--D 946

Query: 211 SGVYSRAGASHGYQMPPGSPPHRQD 285
G + R G G PPG P + D
Sbjct: 947 PGSHGRVG-DRGPAGPPGGPGDKGD 970


>sp|P35085|CBPP_DICDI Calcium-binding protein P OS=Dictyostelium
discoideum GN=cbpP PE=2 SV=2
Length = 467

Score = 35.8 bits (81), Expect = 0.14
Identities = 26/84 (30%), Positives = 30/84 (35%), Gaps = 2/84 (2%)
Frame = +1

Query: 55 SNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQYSDMD--SGVYSR 228
S G P + G G+P P GAY GQP + Q G Y G Y
Sbjct: 182 SGQPGAYPPQQGVQNTLAKTGAPGQPGVPPPQGAYPGQPGVPPQQGAYPGQQPPMGAYPP 241

Query: 229 AGASHGYQMPPGSPPHRQDYRQQQ 300
G Y PP P +QQQ
Sbjct: 242 QGQPGAY--PPQGQPGAYPPQQQQ 263


>sp|O35126|ATN1_MOUSE Atrophin-1 OS=Mus musculus GN=Atn1 PE=1 SV=1
Length = 1175

Score = 35.8 bits (81), Expect = 0.14
Identities = 27/97 (27%), Positives = 40/97 (41%), Gaps = 9/97 (9%)
Frame = +1

Query: 13 YPSGNANYA--QGNSYSNVSGGRGP-----NASGTGRAQQYGTSHPQGMPQPAGAYNGQP 171
YP G A+ G N +G GP N+SG+ Y SHP P GA P
Sbjct: 528 YPPGPAHLPPPHGQVSYNQAGPNGPPVSSSNSSGSSSQASYSCSHPSSSQGPQGASYPFP 587

Query: 172 YMTDQAGQYSDMDSGVYSRAGASHGYQ--MPPGSPPH 276
+ + + + + + A + GY+ PPG P +
Sbjct: 588 PVPPVTTSSATLSTVIATVASSPAGYKTASPPGPPQY 624


tr_hit_id Q8GU42
Definition tr|Q8GU42|Q8GU42_PHYPA Putative cyclin dependent kinase OS=Physcomitrella patens
Align length 79
Score (bit) 63.2
E-value 9.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917210|Adiantum capillus-veneris mRNA, clone:
YMU001_000097_F10.
(553 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8GU42|Q8GU42_PHYPA Putative cyclin dependent kinase OS=Physc... 63 9e-09
tr|A9TI36|A9TI36_PHYPA Predicted protein OS=Physcomitrella paten... 63 9e-09
tr|A9RDY5|A9RDY5_PHYPA Predicted protein OS=Physcomitrella paten... 59 1e-07
tr|A9SUV3|A9SUV3_PHYPA Predicted protein OS=Physcomitrella paten... 59 2e-07
tr|B3LZS5|B3LZS5_DROAN GF18297 OS=Drosophila ananassae GN=GF1829... 45 0.003
tr|Q5DT20|Q5DT20_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=2 SV=1 44 0.004
tr|Q5U1F4|Q5U1F4_HUMAN Hornerin OS=Homo sapiens PE=2 SV=1 43 0.010
tr|A7R655|A7R655_VITVI Chromosome undetermined scaffold_1171, wh... 42 0.017
tr|Q29FF5|Q29FF5_DROPS GA14321 OS=Drosophila pseudoobscura pseud... 42 0.022
tr|B4K644|B4K644_DROMO GI23527 OS=Drosophila mojavensis GN=GI235... 41 0.037
tr|Q4JYA1|Q4JYA1_CORJK Putative uncharacterized protein OS=Coryn... 41 0.049
tr|A3ASB9|A3ASB9_ORYSJ Putative uncharacterized protein OS=Oryza... 41 0.049
tr|B4NNU3|B4NNU3_DROWI GK19428 OS=Drosophila willistoni GN=GK194... 41 0.049
tr|B6Q7L3|B6Q7L3_PENMA High expression lethality protein Hel10, ... 41 0.049
tr|A5DZ07|A5DZ07_LODEL Putative uncharacterized protein OS=Lodde... 41 0.049
tr|B7ZX40|B7ZX40_MAIZE Putative uncharacterized protein OS=Zea m... 40 0.064
tr|B6U109|B6U109_MAIZE Serine/threonine-protein kinase bur1 OS=Z... 40 0.064
tr|B4F9F3|B4F9F3_MAIZE Putative uncharacterized protein OS=Zea m... 40 0.064
tr|Q2J4Y2|Q2J4Y2_FRASC Mername-AA223 peptidase. Metallo peptidas... 40 0.083
tr|A7PG30|A7PG30_VITVI Chromosome chr6 scaffold_15, whole genome... 40 0.083
tr|A2ZJD2|A2ZJD2_ORYSI Putative uncharacterized protein OS=Oryza... 40 0.083
tr|B4MIL6|B4MIL6_DROWI GK10471 OS=Drosophila willistoni GN=GK104... 40 0.083
tr|A9UP18|A9UP18_MONBE Predicted protein OS=Monosiga brevicollis... 40 0.083
tr|Q1KKS6|Q1KKS6_FUGRU Heterogeneous nuclear ribonucleoprotein A... 40 0.11
tr|Q868B4|Q868B4_CAEEL Protein ZK643.8, partially confirmed by t... 40 0.11
tr|B4Q539|B4Q539_DROSI GD23911 OS=Drosophila simulans GN=GD23911... 40 0.11
tr|B4K4Q6|B4K4Q6_DROMO GI23003 OS=Drosophila mojavensis GN=GI230... 40 0.11
tr|B4IEP3|B4IEP3_DROSE GM10663 OS=Drosophila sechellia GN=GM1066... 40 0.11
tr|A4R1S1|A4R1S1_MAGGR Putative uncharacterized protein OS=Magna... 40 0.11
tr|Q0RRJ8|Q0RRJ8_FRAAA Putative uncharacterized protein OS=Frank... 39 0.14

>tr|Q8GU42|Q8GU42_PHYPA Putative cyclin dependent kinase
OS=Physcomitrella patens GN=cdk PE=2 SV=1
Length = 563

Score = 63.2 bits (152), Expect = 9e-09
Identities = 42/79 (53%), Positives = 46/79 (58%)
Frame = +1

Query: 67 GGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQYSDMDSGVYSRAGASHG 246
GGRGP G G QQ+G G PQP AY GQ YM QY D+D G Y+RA S G
Sbjct: 495 GGRGPPVGGRG--QQFGGM--PGGPQPP-AYGGQHYMQQPTAQYVDID-GAYARASHS-G 547

Query: 247 YQMPPGSPPHRQDYRQQQR 303
+Q P PHR DYRQQQR
Sbjct: 548 FQPPS---PHRPDYRQQQR 563


>tr|A9TI36|A9TI36_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_170206 PE=4 SV=1
Length = 562

Score = 63.2 bits (152), Expect = 9e-09
Identities = 42/79 (53%), Positives = 46/79 (58%)
Frame = +1

Query: 67 GGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQYSDMDSGVYSRAGASHG 246
GGRGP G G QQ+G G PQP AY GQ YM QY D+D G Y+RA S G
Sbjct: 494 GGRGPPVGGRG--QQFGGM--PGGPQPP-AYGGQHYMQQPTAQYVDID-GAYARASHS-G 546

Query: 247 YQMPPGSPPHRQDYRQQQR 303
+Q P PHR DYRQQQR
Sbjct: 547 FQPPS---PHRPDYRQQQR 562


>tr|A9RDY5|A9RDY5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_112137 PE=4 SV=1
Length = 563

Score = 59.3 bits (142), Expect = 1e-07
Identities = 51/103 (49%), Positives = 56/103 (54%), Gaps = 2/103 (1%)
Frame = +1

Query: 1 RGSNY--PSGNANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPY 174
RG Y P+G A YA G GGRGP G G QQ+G G PQP AY GQ Y
Sbjct: 476 RGGPYGGPTGGA-YAAGP----YGGGRGPPIGGRG--QQFGGM--AGGPQPP-AYGGQHY 525

Query: 175 MTDQAGQYSDMDSGVYSRAGASHGYQMPPGSPPHRQDYRQQQR 303
M QY D+D G Y+RA S G+Q P S P R DYRQQQR
Sbjct: 526 MQQPTAQYVDID-GAYARASHS-GFQ--PLS-PRRPDYRQQQR 563


>tr|A9SUV3|A9SUV3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_135647 PE=4 SV=1
Length = 561

Score = 58.5 bits (140), Expect = 2e-07
Identities = 43/95 (45%), Positives = 49/95 (51%), Gaps = 7/95 (7%)
Frame = +1

Query: 40 QGNSYSNVSGGR---GPNASG----TGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQY 198
+G Y +GG GP G GR QQ+G P G PA Y QP QY
Sbjct: 477 RGGGYGGPAGGAYAAGPYGGGKVPPVGRGQQFG-GMPGGPQPPAYGYMQQP-----TAQY 530

Query: 199 SDMDSGVYSRAGASHGYQMPPGSPPHRQDYRQQQR 303
D+D G Y+RA S G+Q P SPPHR DYRQQQR
Sbjct: 531 VDID-GAYARASHS-GFQPP--SPPHRPDYRQQQR 561


>tr|B3LZS5|B3LZS5_DROAN GF18297 OS=Drosophila ananassae GN=GF18297
PE=4 SV=1
Length = 1554

Score = 44.7 bits (104), Expect = 0.003
Identities = 30/84 (35%), Positives = 34/84 (40%), Gaps = 4/84 (4%)
Frame = +1

Query: 46 NSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQY---SDMDSG 216
N+ N RGPN G G G H G+ Q G GQP Q GQ+ MD G
Sbjct: 785 NTVRNAVARRGPNQMGMGPQLPQGP-HQMGVQQQMGVMPGQPGQPGQPGQHMMGQQMDHG 843

Query: 217 VYS-RAGASHGYQMPPGSPPHRQD 285
Y G Q PG P H+ D
Sbjct: 844 QYDPNQMQQQGMQPQPGQPGHQPD 867


>tr|Q5DT20|Q5DT20_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=2 SV=1
Length = 2850

Score = 44.3 bits (103), Expect = 0.004
Identities = 34/111 (30%), Positives = 48/111 (43%), Gaps = 4/111 (3%)
Frame = +1

Query: 7 SNYPSGNANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQ 186
++Y +++Y + NS S+ S GRG SG+G++ YG G+ +GQ D
Sbjct: 170 NSYSGQSSSYGEQNSDSHQSSGRGQCGSGSGQSPNYGQH---------GSGSGQSSSNDT 220

Query: 187 AGQYSDMDSGV---YSRAGASHGYQMPPGSPPHRQDYRQQ-QR*NLSMQGD 327
G S SG S +G S GY H Y Q R S +GD
Sbjct: 221 HGSGSGQSSGFSQHKSSSGQSSGYSQHGSGSGHSSGYGQHGSRSGQSSRGD 271



Score = 36.6 bits (83), Expect = 0.92
Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 6/96 (6%)
Frame = +1

Query: 25 NANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPA----GAYNGQPYMTDQAG 192
+++Y Q S S+ + GRG + SG+G++ +G P+ G+ +G+ + + G
Sbjct: 864 SSSYGQHESASHHASGRGRHGSGSGQSPGHGQRGSGSGQSPSYGRHGSGSGRSSSSGRHG 923

Query: 193 QYSDMDSGV--YSRAGASHGYQMPPGSPPHRQDYRQ 294
S SG S +G S GY H Y Q
Sbjct: 924 SGSGQSSGFGHKSSSGQSSGYTQHGSGSGHSSSYEQ 959



Score = 35.0 bits (79), Expect = 2.7
Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
Frame = +1

Query: 25 NANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQYSD 204
+++Y Q S S S GRG ++SG+G++ +G P+ +G G
Sbjct: 397 SSSYGQHESASRHSSGRGQHSSGSGQSPGHGQRGSGSGQSPSSGQHG-------TGFGRS 449

Query: 205 MDSGVY-SRAGASHGYQMPPGSPPHRQDYRQ 294
SG Y S +G S G+ S H Y Q
Sbjct: 450 SSSGPYVSGSGYSSGFGHHESSSEHSSGYTQ 480



Score = 34.3 bits (77), Expect = 4.6
Identities = 31/100 (31%), Positives = 44/100 (44%)
Frame = +1

Query: 4 GSNYPSGNANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTD 183
GS+ SG + G+ S G G SG+G++ YG H G Q +G Y+ +
Sbjct: 2752 GSSQSSGYGRHGAGSGQSLSHGRHG---SGSGQSSSYG-QHGSGSGQSSG-YSQHGSGSG 2806

Query: 184 QAGQYSDMDSGVYSRAGASHGYQMPPGSPPHRQDYRQQQR 303
Q G YS G G+S Y + S +Y Q+QR
Sbjct: 2807 QDG-YSYCKGGSNHDGGSSGSYFLSFPSSTSTYEYVQEQR 2845


>tr|Q5U1F4|Q5U1F4_HUMAN Hornerin OS=Homo sapiens PE=2 SV=1
Length = 2850

Score = 43.1 bits (100), Expect = 0.010
Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 3/99 (3%)
Frame = +1

Query: 7 SNYPSGNANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQ 186
++Y +++Y + NS S+ S GRG SG+G++ YG G+ +GQ D
Sbjct: 170 NSYSGQSSSYGEQNSDSHQSSGRGQCGSGSGQSPNYGQH---------GSGSGQSSSNDT 220

Query: 187 AGQYSDMDSGV---YSRAGASHGYQMPPGSPPHRQDYRQ 294
G S SG S +G S GY H Y Q
Sbjct: 221 HGSGSGQSSGFSQHKSSSGQSSGYSQHGSGSGHSSGYGQ 259



Score = 36.6 bits (83), Expect = 0.92
Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 6/96 (6%)
Frame = +1

Query: 25 NANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPA----GAYNGQPYMTDQAG 192
+++Y Q S S+ + GRG + SG+G++ +G P+ G+ +G+ + + G
Sbjct: 864 SSSYGQHESASHHASGRGRHGSGSGQSPGHGQRGSGSGQSPSYGRHGSGSGRSSSSGRHG 923

Query: 193 QYSDMDSGV--YSRAGASHGYQMPPGSPPHRQDYRQ 294
S SG S +G S GY H Y Q
Sbjct: 924 SGSGQSSGFGHKSSSGQSSGYTQHGSGSGHSSSYEQ 959



Score = 35.0 bits (79), Expect = 2.7
Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
Frame = +1

Query: 25 NANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQYSD 204
+++Y Q S S S GRG ++SG+G++ +G P+ +G G
Sbjct: 397 SSSYGQHESASRHSSGRGQHSSGSGQSPGHGQRGSGSGQSPSSGQHG-------TGFGRS 449

Query: 205 MDSGVY-SRAGASHGYQMPPGSPPHRQDYRQ 294
SG Y S +G S G+ S H Y Q
Sbjct: 450 SSSGPYVSGSGYSSGFGHHESSSEHSSGYTQ 480



Score = 33.9 bits (76), Expect = 6.0
Identities = 31/100 (31%), Positives = 44/100 (44%)
Frame = +1

Query: 4 GSNYPSGNANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTD 183
GS+ SG + G+ S G G SG+G++ YG H G Q +G Y+ +
Sbjct: 2752 GSSQSSGYGRHGAGSGQSLSHGRHG---SGSGQSSSYG-QHGSGSGQSSG-YSQHGSGSG 2806

Query: 184 QAGQYSDMDSGVYSRAGASHGYQMPPGSPPHRQDYRQQQR 303
Q G YS G G+S Y + S +Y Q+QR
Sbjct: 2807 QDG-YSYCKGGSNHDGGSSGSYFLSFPSSTSPYEYVQEQR 2845


>tr|A7R655|A7R655_VITVI Chromosome undetermined scaffold_1171, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00007988001 PE=4 SV=1
Length = 516

Score = 42.4 bits (98), Expect = 0.017
Identities = 18/37 (48%), Positives = 21/37 (56%)
Frame = +1

Query: 7 SNYPSGNANYAQGNSYSNVSGGRGPNASGTGRAQQYG 117
S Y G NY+Q + Y + GRGPN G R QQYG
Sbjct: 477 SGYGVGPPNYSQSSQYGGAAAGRGPNPMGVNRNQQYG 513


>tr|Q29FF5|Q29FF5_DROPS GA14321 OS=Drosophila pseudoobscura
pseudoobscura GN=GA14321 PE=4 SV=2
Length = 1478

Score = 42.0 bits (97), Expect = 0.022
Identities = 32/102 (31%), Positives = 44/102 (43%), Gaps = 4/102 (3%)
Frame = +1

Query: 4 GSNYPSGNANYAQGNSYSNVSGGRG----PNASGTGRAQQYGTSHPQGMPQPAGAYNGQP 171
G NY SG + A G+ ++ GG P++SG G+ H G P A+ QP
Sbjct: 786 GGNYGSGGSG-AGGSVLASSGGGASASNIPSSSG-------GSHHHHGAPV---AHVQQP 834

Query: 172 YMTDQAGQYSDMDSGVYSRAGASHGYQMPPGSPPHRQDYRQQ 297
Y G + + S A+ GYQ PP PH Q + Q
Sbjct: 835 YSASSGGHH------IVSNCQANGGYQQPPSHAPHPQQQQHQ 870


>tr|B4K644|B4K644_DROMO GI23527 OS=Drosophila mojavensis GN=GI23527
PE=4 SV=1
Length = 646

Score = 41.2 bits (95), Expect = 0.037
Identities = 32/104 (30%), Positives = 42/104 (40%), Gaps = 7/104 (6%)
Frame = +1

Query: 10 NYPSGNANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQA 189
N G+ N Q S SN G + G+ QQY Q G++NGQ
Sbjct: 267 NQKQGSFNGQQSQSSSN-----GQQSQGSSNGQQYQPDQRSPYNQKQGSFNGQQSQGSSN 321

Query: 190 GQYS-DMDSGVYSRAGASHGYQMPPGS------PPHRQDYRQQQ 300
GQ S D +G S +G S+G Q S P R Y ++Q
Sbjct: 322 GQQSQDSSNGWQSESGLSNGQQSQDSSNGQQFQPYQRSPYSRKQ 365



Score = 38.1 bits (87), Expect = 0.32
Identities = 26/84 (30%), Positives = 35/84 (41%), Gaps = 1/84 (1%)
Frame = +1

Query: 19 SGNANYAQGNSYSNVSGGRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQY 198
S N +QG+S G + G+ QQY Q G++NGQ GQ
Sbjct: 158 SSNGQQSQGSS-------NGQQSQGSSNGQQYQPDQRSPYNQKQGSFNGQQSQGSSNGQQ 210

Query: 199 S-DMDSGVYSRAGASHGYQMPPGS 267
S D +G S +G S+G Q S
Sbjct: 211 SQDSSNGWQSESGLSNGQQSQDSS 234



Score = 37.7 bits (86), Expect = 0.41
Identities = 27/99 (27%), Positives = 39/99 (39%), Gaps = 1/99 (1%)
Frame = +1

Query: 7 SNYPSGNANYAQGNSYSNVSG-GRGPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTD 183
S +G + N + + SG G + G+ QQY Q G++NGQ +
Sbjct: 222 SGLSNGQQSQDSSNGWQSESGLSNGQQSQGSSNGQQYQPDQRSPYNQKQGSFNGQQSQSS 281

Query: 184 QAGQYSDMDSGVYSRAGASHGYQMPPGSPPHRQDYRQQQ 300
GQ S G+S+G Q P R Y Q+Q
Sbjct: 282 SNGQQSQ---------GSSNGQQY---QPDQRSPYNQKQ 308



Score = 35.0 bits (79), Expect = 2.7
Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 1/65 (1%)
Frame = +1

Query: 76 GPNASGTGRAQQYGTSHPQGMPQPAGAYNGQPYMTDQAGQYS-DMDSGVYSRAGASHGYQ 252
G + G+ QQY Q G++NGQ GQ S D +G S +G S+G Q
Sbjct: 56 GQQSQGSSNGQQYQPDQRSPYNQKQGSFNGQQSQGSSNGQQSQDSSNGWQSESGLSNGQQ 115

Query: 253 MPPGS 267
S
Sbjct: 116 SQDSS 120