BP917219
Clone id YMU001_000097_G08
Library
Length 360
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000097_G08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TCGAAGAAATGTTTAACAGGCCAATATAAGCACATCAATATTGTCTGTATGATTGTCCTC
AAATCACTTACACAAGTTGAACTTCATTCCATCTGATCATACCCATTCTGTCTAAGAAAA
GCACCTTTCTTCCGTGAGTACATGACGACATTCAGTAAGACATTGCATCTACATCATCAA
CCAGGAAACCTTAGGTTCAATAATGTCAACCAAGGCATCTTGATGGACAACATTGTCGTC
CGGATGTAAGCATTGTCGTAAACGCCTTGCATGTTTAAACAGAGAAGAAATATTTAGCCA
CAGGGTGAAAGCTTCTTGTTTCCAGATCCCTTGGGATTTTCATCCTTCCAATCATCCCAT
■■Homology search results ■■ -
sp_hit_id Q8LDQ4
Definition sp|Q8LDQ4|TAP46_ARATH PP2A regulatory subunit TAP46 OS=Arabidopsis thaliana
Align length 15
Score (bit) 32.7
E-value 0.58
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917219|Adiantum capillus-veneris mRNA, clone:
YMU001_000097_G08.
(342 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8LDQ4|TAP46_ARATH PP2A regulatory subunit TAP46 OS=Arabidops... 33 0.58
sp|O97239|DOP1_PLAF7 Protein dopey homolog PFC0245c OS=Plasmodiu... 31 2.2
sp|P04496|L52_ADE05 Late L1 52 kDa protein OS=Human adenovirus C... 30 3.7
sp|P03262|L52_ADE02 Late L1 52 kDa protein OS=Human adenovirus C... 30 3.7
sp|P40061|TSC11_YEAST Target of rapamycin complex 2 subunit TSC1... 29 6.4
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1... 29 8.3

>sp|Q8LDQ4|TAP46_ARATH PP2A regulatory subunit TAP46 OS=Arabidopsis
thaliana GN=TAP46 PE=1 SV=2
Length = 405

Score = 32.7 bits (73), Expect = 0.58
Identities = 11/15 (73%), Positives = 15/15 (100%)
Frame = -2

Query: 341 ENPKGSGNKKLSPCG 297
+NP+G+GNKKL+PCG
Sbjct: 391 DNPRGAGNKKLTPCG 405


>sp|O97239|DOP1_PLAF7 Protein dopey homolog PFC0245c OS=Plasmodium
falciparum (isolate 3D7) GN=PFC0245c PE=2 SV=1
Length = 3933

Score = 30.8 bits (68), Expect = 2.2
Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 1/37 (2%)
Frame = -1

Query: 315 EAFTLWLNISSLFKHARRLRQCLHP-DDNVVHQDALV 208
E + L++N+SS F RRL QCL+P + VH AL+
Sbjct: 48 EKYELFVNVSSKFLLFRRLSQCLNPLLPSGVHSKALI 84


>sp|P04496|L52_ADE05 Late L1 52 kDa protein OS=Human adenovirus C
serotype 5 PE=3 SV=2
Length = 415

Score = 30.0 bits (66), Expect = 3.7
Identities = 14/44 (31%), Positives = 25/44 (56%)
Frame = -1

Query: 246 HPDDNVVHQDALVDIIEPKVSWLMM*MQCLTECRHVLTEERCFS 115
H DN +DAL++I+EP+ WL + + + ++ +ER S
Sbjct: 220 HSRDNEAFRDALLNIVEPEGRWL---LDLINILQSIVVQERSLS 260


>sp|P03262|L52_ADE02 Late L1 52 kDa protein OS=Human adenovirus C
serotype 2 PE=3 SV=1
Length = 415

Score = 30.0 bits (66), Expect = 3.7
Identities = 14/44 (31%), Positives = 25/44 (56%)
Frame = -1

Query: 246 HPDDNVVHQDALVDIIEPKVSWLMM*MQCLTECRHVLTEERCFS 115
H DN +DAL++I+EP+ WL + + + ++ +ER S
Sbjct: 220 HSRDNEAFRDALLNIVEPEGRWL---LDLINILQSIVVQERSLS 260


>sp|P40061|TSC11_YEAST Target of rapamycin complex 2 subunit TSC11
OS=Saccharomyces cerevisiae GN=TSC11 PE=1 SV=1
Length = 1430

Score = 29.3 bits (64), Expect = 6.4
Identities = 18/61 (29%), Positives = 29/61 (47%)
Frame = +1

Query: 145 TTFSKTLHLHHQPGNLRFNNVNQGILMDNIVVRM*ALS*TPCMFKQRRNI*PQGESFLFP 324
T F + L + ++P LRF+NVN+G + V++ C F + P+G L
Sbjct: 783 TKFIRRLLVFYRPLRLRFSNVNKGAKLSQKYVQV------GCQFFKTLTATPEGMKILMD 836

Query: 325 D 327
D
Sbjct: 837 D 837


>sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1
OS=Mus musculus GN=Abca1 PE=1 SV=3
Length = 2261

Score = 28.9 bits (63), Expect = 8.3
Identities = 14/30 (46%), Positives = 18/30 (60%)
Frame = -1

Query: 294 NISSLFKHARRLRQCLHPDDNVVHQDALVD 205
+I + K R LRQ HP+ N+ QD LVD
Sbjct: 121 SIKDMHKVLRMLRQIKHPNSNLKLQDFLVD 150


tr_hit_id B2IUR2
Definition tr|B2IUR2|B2IUR2_NOSP7 Putative uncharacterized protein OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Align length 54
Score (bit) 34.3
E-value 3.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917219|Adiantum capillus-veneris mRNA, clone:
YMU001_000097_G08.
(342 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B2IUR2|B2IUR2_NOSP7 Putative uncharacterized protein OS=Nosto... 34 3.2
tr|Q84PC7|Q84PC7_ORYSJ PP2A regulatory subunit-like protein OS=O... 33 9.3
tr|Q40666|Q40666_ORYSA Chilling-inducible protein OS=Oryza sativ... 33 9.3
tr|Q2RAR3|Q2RAR3_ORYSJ TAP42-like family protein, expressed OS=O... 33 9.3
tr|Q2QY04|Q2QY04_ORYSJ Os12g0137500 protein OS=Oryza sativa subs... 33 9.3
tr|Q0IUQ6|Q0IUQ6_ORYSJ Os11g0141000 protein (Fragment) OS=Oryza ... 33 9.3
tr|B8BJ07|B8BJ07_ORYSI Putative uncharacterized protein OS=Oryza... 33 9.3
tr|B6TVR5|B6TVR5_MAIZE PP2A regulatory subunit TAP46 OS=Zea mays... 33 9.3
tr|B6T4L7|B6T4L7_MAIZE PP2A regulatory subunit TAP46 OS=Zea mays... 33 9.3
tr|B4FR84|B4FR84_MAIZE Putative uncharacterized protein OS=Zea m... 33 9.3
tr|B4FQH3|B4FQH3_MAIZE Putative uncharacterized protein OS=Zea m... 33 9.3
tr|A9S7L7|A9S7L7_PHYPA Predicted protein OS=Physcomitrella paten... 33 9.3
tr|A7QF26|A7QF26_VITVI Chromosome chr16 scaffold_86, whole genom... 33 9.3
tr|A3CES3|A3CES3_ORYSJ Putative uncharacterized protein OS=Oryza... 33 9.3
tr|A3C8H5|A3C8H5_ORYSJ Putative uncharacterized protein OS=Oryza... 33 9.3
tr|A2ZBB1|A2ZBB1_ORYSI Putative uncharacterized protein OS=Oryza... 33 9.3

>tr|B2IUR2|B2IUR2_NOSP7 Putative uncharacterized protein OS=Nostoc
punctiforme (strain ATCC 29133 / PCC 73102)
GN=Npun_R4470 PE=4 SV=1
Length = 433

Score = 34.3 bits (77), Expect = 3.2
Identities = 18/54 (33%), Positives = 28/54 (51%)
Frame = +1

Query: 22 QYKHINIVCMIVLKSLTQVELHSI*SYPFCLRKAPFFREYMTTFSKTLHLHHQP 183
++ + + M LTQ+ H I + P LR +P FR+ M +F K L L + P
Sbjct: 208 RHDQVTALEMFASPLLTQLSCHIIYAIPISLRYSPSFRQPMESFQKCLDLTNPP 261


>tr|Q84PC7|Q84PC7_ORYSJ PP2A regulatory subunit-like protein
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 418

Score = 32.7 bits (73), Expect = 9.3
Identities = 11/15 (73%), Positives = 15/15 (100%)
Frame = -2

Query: 341 ENPKGSGNKKLSPCG 297
+NP+G+GNKKL+PCG
Sbjct: 404 DNPRGAGNKKLTPCG 418


>tr|Q40666|Q40666_ORYSA Chilling-inducible protein OS=Oryza sativa
PE=2 SV=1
Length = 379

Score = 32.7 bits (73), Expect = 9.3
Identities = 11/15 (73%), Positives = 15/15 (100%)
Frame = -2

Query: 341 ENPKGSGNKKLSPCG 297
+NP+G+GNKKL+PCG
Sbjct: 365 DNPRGAGNKKLTPCG 379


>tr|Q2RAR3|Q2RAR3_ORYSJ TAP42-like family protein, expressed
OS=Oryza sativa subsp. japonica GN=LOC_Os11g04520 PE=4
SV=2
Length = 418

Score = 32.7 bits (73), Expect = 9.3
Identities = 11/15 (73%), Positives = 15/15 (100%)
Frame = -2

Query: 341 ENPKGSGNKKLSPCG 297
+NP+G+GNKKL+PCG
Sbjct: 404 DNPRGAGNKKLTPCG 418


>tr|Q2QY04|Q2QY04_ORYSJ Os12g0137500 protein OS=Oryza sativa subsp.
japonica GN=Os12g0137500 PE=2 SV=1
Length = 418

Score = 32.7 bits (73), Expect = 9.3
Identities = 11/15 (73%), Positives = 15/15 (100%)
Frame = -2

Query: 341 ENPKGSGNKKLSPCG 297
+NP+G+GNKKL+PCG
Sbjct: 404 DNPRGAGNKKLTPCG 418


>tr|Q0IUQ6|Q0IUQ6_ORYSJ Os11g0141000 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os11g0141000 PE=4 SV=1
Length = 353

Score = 32.7 bits (73), Expect = 9.3
Identities = 11/15 (73%), Positives = 15/15 (100%)
Frame = -2

Query: 341 ENPKGSGNKKLSPCG 297
+NP+G+GNKKL+PCG
Sbjct: 339 DNPRGAGNKKLTPCG 353


>tr|B8BJ07|B8BJ07_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_35047 PE=4 SV=1
Length = 365

Score = 32.7 bits (73), Expect = 9.3
Identities = 11/15 (73%), Positives = 15/15 (100%)
Frame = -2

Query: 341 ENPKGSGNKKLSPCG 297
+NP+G+GNKKL+PCG
Sbjct: 351 DNPRGAGNKKLTPCG 365


>tr|B6TVR5|B6TVR5_MAIZE PP2A regulatory subunit TAP46 OS=Zea mays
PE=2 SV=1
Length = 416

Score = 32.7 bits (73), Expect = 9.3
Identities = 11/15 (73%), Positives = 15/15 (100%)
Frame = -2

Query: 341 ENPKGSGNKKLSPCG 297
+NP+G+GNKKL+PCG
Sbjct: 402 DNPRGAGNKKLTPCG 416


>tr|B6T4L7|B6T4L7_MAIZE PP2A regulatory subunit TAP46 OS=Zea mays
PE=2 SV=1
Length = 423

Score = 32.7 bits (73), Expect = 9.3
Identities = 11/15 (73%), Positives = 15/15 (100%)
Frame = -2

Query: 341 ENPKGSGNKKLSPCG 297
+NP+G+GNKKL+PCG
Sbjct: 409 DNPRGAGNKKLTPCG 423


>tr|B4FR84|B4FR84_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 416

Score = 32.7 bits (73), Expect = 9.3
Identities = 11/15 (73%), Positives = 15/15 (100%)
Frame = -2

Query: 341 ENPKGSGNKKLSPCG 297
+NP+G+GNKKL+PCG
Sbjct: 402 DNPRGAGNKKLTPCG 416