BP917224
Clone id YMU001_000097_H06
Library
Length 515
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000097_H06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CCGAAGGGAATAAACCAAGTGTTAGTATCCAAAGAGCACATCAAAGTCAAAGACCCAGTG
TGGATACATGAAGCATGGGTTCAACCACAACAACAAAAGGTGACAGGTGGGTAGCATCAA
ATAAGTCAATCACTGCTCAGGGATACTTCCAAGGAAACGCTAATGTTTGGGCCAAAAAGC
CTAAATTAATAGCCTAGACCTACCCATCTCAACCAACGTGTTCTACAAAGAACAAGATCC
GCTATAAACACAAGACAAACAACTCAAATTGGAGAAAGAAAAACCACAAAAGGCAAAAGA
AAAGACCTTCCAAGCAAAAAATGCGACAAGTTTAAGTACCAAAGTTAGACGCTAGTCAAG
TTACCCAAGAAAAACATGTGAAACAACGGATGATTCCAGTGAAGCTACTCATATCACAAG
GATTTCATGAAGGTAACACTCAAATATGGTTACCAAAAGTTGTAGCTCAGTCTGGAACAA
CCAAGAAAAATCATGTACACAAGTTTCTGTCCTAA
■■Homology search results ■■ -
sp_hit_id Q54LU8
Definition sp|Q54LU8|Y8646_DICDI Probable serine/threonine-protein kinase DDB_G0286465 OS=Dictyostelium discoideum
Align length 121
Score (bit) 32.0
E-value 1.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917224|Adiantum capillus-veneris mRNA, clone:
YMU001_000097_H06.
(515 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q54LU8|Y8646_DICDI Probable serine/threonine-protein kinase D... 32 1.8
sp|Q9PQW0|Y183_UREPA Uncharacterized protein UU183 OS=Ureaplasma... 32 2.3
sp|O75420|PERQ1_HUMAN PERQ amino acid-rich with GYF domain-conta... 31 3.0
sp|A7UXD4|CHL1_NEUCR ATP-dependent RNA helicase chl-1 OS=Neurosp... 31 3.0
sp|P21401|VGLM_RVFVZ Envelope glycoprotein OS=Rift valley fever ... 31 3.9
sp|A6H690|IQCAL_MOUSE IQ and AAA domain-containing protein ENSP0... 31 3.9
sp|Q5VWG9|TAF3_HUMAN Transcription initiation factor TFIID subun... 30 5.1
sp|Q3KRF1|SP110_RAT Sp110 nuclear body protein OS=Rattus norvegi... 30 5.1
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c... 30 6.7
sp|Q54I66|Y9399_DICDI Putative uncharacterized protein DDB_G0288... 30 6.7
sp|P0C5Y8|ALS2_RAT Alsin OS=Rattus norvegicus GN=Als2 PE=2 SV=1 30 6.7
sp|Q13823|NOG2_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sap... 30 8.7
sp|Q6IMN6|CAPR2_HUMAN Caprin-2 OS=Homo sapiens GN=CAPRIN2 PE=1 SV=1 30 8.7

>sp|Q54LU8|Y8646_DICDI Probable serine/threonine-protein kinase
DDB_G0286465 OS=Dictyostelium discoideum GN=DDB_G0286465
PE=3 SV=1
Length = 1221

Score = 32.0 bits (71), Expect = 1.8
Identities = 26/121 (21%), Positives = 55/121 (45%), Gaps = 4/121 (3%)
Frame = +3

Query: 150 QGNANVWAKKPKLIA*TYPSQPTCSTKNKIRYKHKTNNS-NWRKKNHKRQKKRPSKQKM- 323
QG + + + ++ +P + CS N + K K N K+N +++KK+ KQK
Sbjct: 1071 QGVSRIKSTDYPALSDLFPKKKRCSENNFVFEKEKKQEKENKEKENKEKEKKQLEKQKQL 1130

Query: 324 --RQV*VPKLDASQVTQEKHVKQRMIPVKLLISQGFHEGNTQIWLPKVVAQSGTTKKNHV 497
++ +L+ ++ +E+ K + K L ++ + + L K + +KKN
Sbjct: 1131 EREKLEKDRLEKDRLEKEQQEKDCLEREKFLENERLEKEQEREKLEKEIKILVVSKKNRT 1190

Query: 498 H 500
+
Sbjct: 1191 N 1191


>sp|Q9PQW0|Y183_UREPA Uncharacterized protein UU183 OS=Ureaplasma
parvum GN=UU183 PE=4 SV=1
Length = 291

Score = 31.6 bits (70), Expect = 2.3
Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 11/80 (13%)
Frame = +3

Query: 117 SNKSITAQGYFQGNANVWAKKPKLIA*TYPSQPTCSTKNKIRYKHK------TNNSNWRK 278
+N+++T + NAN++ K KLI TY + I Y + N NW+
Sbjct: 196 NNENLTFNPSYNYNANLYFTKAKLIYCTYTIIGIIFIISFIYYLSEIIKRCLLVNDNWKI 255

Query: 279 KNHKRQ-----KKRPSKQKM 323
K H+R+ KKR +KQ++
Sbjct: 256 KQHERKDGLNIKKRKNKQEI 275


>sp|O75420|PERQ1_HUMAN PERQ amino acid-rich with GYF
domain-containing protein 1 OS=Homo sapiens GN=GIGYF1
PE=1 SV=2
Length = 1035

Score = 31.2 bits (69), Expect = 3.0
Identities = 15/64 (23%), Positives = 35/64 (54%)
Frame = +3

Query: 228 KNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRMIPVKL 407
+ ++ + K +++ KR++++ +QK RQ + ++ + KHV+Q+ + +KL
Sbjct: 688 RREVELRAKREEEERKRREEKRRQQQQEEQKRRQ------EEEELFRRKHVRQQELLLKL 741

Query: 408 LISQ 419
L Q
Sbjct: 742 LQQQ 745


>sp|A7UXD4|CHL1_NEUCR ATP-dependent RNA helicase chl-1 OS=Neurospora
crassa GN=chl-1 PE=3 SV=1
Length = 1073

Score = 31.2 bits (69), Expect = 3.0
Identities = 12/27 (44%), Positives = 16/27 (59%)
Frame = +1

Query: 31 KEHIKVKDPVWIHEAWVQPQQQKVTGG 111
KEH++ K P WI E W + Q+Q G
Sbjct: 1021 KEHVRAKLPGWIREGWDETQRQAKEDG 1047


>sp|P21401|VGLM_RVFVZ Envelope glycoprotein OS=Rift valley fever
virus (strain ZH-548 M12) GN=M PE=3 SV=1
Length = 1197

Score = 30.8 bits (68), Expect = 3.9
Identities = 19/71 (26%), Positives = 33/71 (46%)
Frame = -3

Query: 285 GFSFSNLSCLSCVYSGSCSL*NTLVEMGRSRLLI*AFWPKH*RFLGSIPEQ*LTYLMLPT 106
G + + +C Y+G+CS + L+E G+ L + H L ++ + + P+
Sbjct: 171 GMTQEDATCKPVTYAGACSSFDVLLEKGKFPLF--QSYAHHRTLLEAVHDTIIAKADPPS 228

Query: 105 CHLLLLWLNPC 73
C LL NPC
Sbjct: 229 CDLLSAHGNPC 239


>sp|A6H690|IQCAL_MOUSE IQ and AAA domain-containing protein
ENSP00000340148 homolog OS=Mus musculus PE=2 SV=2
Length = 825

Score = 30.8 bits (68), Expect = 3.9
Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
Frame = +3

Query: 225 TKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQK-MRQV*VPKLDASQVTQEKHVKQRMIPV 401
T ++R + RKK+ ++++K K+K ++ K+ +V +E V R++P
Sbjct: 333 TPEQVRLDLEAQAQESRKKDQEKKEKNKEKEKEKKEKKKKKVKEEKVKKEPEVMFRVLPS 392

Query: 402 KLL-ISQGFHEGNTQIW 449
K + + HE T +W
Sbjct: 393 KSIPVINAGHEEYTSVW 409


>sp|Q5VWG9|TAF3_HUMAN Transcription initiation factor TFIID subunit
3 OS=Homo sapiens GN=TAF3 PE=1 SV=1
Length = 929

Score = 30.4 bits (67), Expect = 5.1
Identities = 14/60 (23%), Positives = 32/60 (53%)
Frame = +3

Query: 228 KNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRMIPVKL 407
K K++ K K + +KK +++K++ K++ ++ + + + KH K ++ PV L
Sbjct: 693 KEKVKEKEKKKDKKEKKKKKEKEKEKKEKEREKEKREREKREKEKEKHKHEKIKVEPVAL 752



Score = 30.0 bits (66), Expect = 6.7
Identities = 15/74 (20%), Positives = 37/74 (50%)
Frame = +3

Query: 171 AKKPKLIA*TYPSQPTCSTKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLD 350
++ P ++ P P + K + K K + ++K K++K++ K+K R+ + +
Sbjct: 672 SRVPAMLPSLLPVLPEKLFEEKEKVKEKEKKKDKKEKKKKKEKEKEKKEKEREKEKRERE 731

Query: 351 ASQVTQEKHVKQRM 392
+ +EKH +++
Sbjct: 732 KREKEKEKHKHEKI 745


>sp|Q3KRF1|SP110_RAT Sp110 nuclear body protein OS=Rattus norvegicus
GN=Sp110 PE=2 SV=1
Length = 478

Score = 30.4 bits (67), Expect = 5.1
Identities = 16/46 (34%), Positives = 22/46 (47%)
Frame = +3

Query: 204 PSQPTCSTKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VP 341
P + C+ NK K K+ W +RQKK+P + KM V P
Sbjct: 263 PQEAPCTPANKKARKRKS--CIWSNSKRRRQKKKPPQHKMMGVASP 306


>sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c
OS=Schizosaccharomyces pombe GN=SPBC2F12.05c PE=1 SV=2
Length = 1310

Score = 30.0 bits (66), Expect = 6.7
Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 2/67 (2%)
Frame = +3

Query: 204 PSQPTCSTKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQ--KMRQV*VPKLDASQVTQEKH 377
PSQ T TK+ K T + + H RQ+ PS+Q + + + + + Q T+ +H
Sbjct: 697 PSQQTTETKHL--RKESTPSKQPTEGQHTRQESLPSQQTTETKHLRKESIPSKQPTEGQH 754

Query: 378 VKQRMIP 398
+Q +P
Sbjct: 755 ARQESLP 761


>sp|Q54I66|Y9399_DICDI Putative uncharacterized protein DDB_G0288973
OS=Dictyostelium discoideum GN=DDB_G0288973 PE=4 SV=1
Length = 461

Score = 30.0 bits (66), Expect = 6.7
Identities = 19/83 (22%), Positives = 33/83 (39%), Gaps = 5/83 (6%)
Frame = +3

Query: 204 PSQPTCSTKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKH-- 377
PSQPT +N+I + NN+N N+ + + + +T +H
Sbjct: 369 PSQPTSPPQNEINNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNSITSIRHLV 422

Query: 378 ---VKQRMIPVKLLISQGFHEGN 437
+ QR+ K L + +GN
Sbjct: 423 LNSINQRIFATKTLKTNEISKGN 445


tr_hit_id A7RGZ8
Definition tr|A7RGZ8|A7RGZ8_NEMVE Predicted protein OS=Nematostella vectensis
Align length 97
Score (bit) 36.6
E-value 0.75
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917224|Adiantum capillus-veneris mRNA, clone:
YMU001_000097_H06.
(515 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7RGZ8|A7RGZ8_NEMVE Predicted protein OS=Nematostella vectens... 37 0.75
tr|Q8IK49|Q8IK49_PLAF7 Putative uncharacterized protein OS=Plasm... 35 2.2
tr|Q23BX2|Q23BX2_TETTH Putative uncharacterized protein OS=Tetra... 35 2.2
tr|A7R151|A7R151_VITVI Chromosome undetermined scaffold_337, who... 35 2.9
tr|Q8MPX4|Q8MPX4_CAEEL Putative uncharacterized protein OS=Caeno... 35 2.9
tr|Q4Z2T9|Q4Z2T9_PLABE Putative uncharacterized protein (Fragmen... 35 2.9
tr|B3L8M7|B3L8M7_PLAKH Putative uncharacterized protein OS=Plasm... 34 3.7
tr|Q8I1N9|Q8I1N9_PLAF7 Putative uncharacterized protein PFD0970c... 34 4.9
tr|Q4XMB8|Q4XMB8_PLACH Putative uncharacterized protein (Fragmen... 33 6.4
tr|Q4N892|Q4N892_THEPA Putative uncharacterized protein OS=Theil... 33 6.4
tr|A7RV08|A7RV08_NEMVE Predicted protein OS=Nematostella vectens... 33 6.4
tr|A2DMU1|A2DMU1_TRIVA Putative uncharacterized protein OS=Trich... 33 6.4
tr|A1L2X1|A1L2X1_XENLA LOC100036977 protein OS=Xenopus laevis GN... 33 8.3
tr|Q54ZW1|Q54ZW1_DICDI Putative uncharacterized protein OS=Dicty... 33 8.3
tr|A8N6P2|A8N6P2_COPC7 Putative uncharacterized protein OS=Copri... 33 8.3

>tr|A7RGZ8|A7RGZ8_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g238183 PE=4 SV=1
Length = 1100

Score = 36.6 bits (83), Expect = 0.75
Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 9/97 (9%)
Frame = +3

Query: 222 STKNKIRYKHKTNNSNWRKKNHKRQKKR-PSKQKMRQV*VPKLDASQVTQEKHVKQRMIP 398
+++ K + KHK ++ + +KK HK++KKR K K +Q K + + T++K K P
Sbjct: 183 NSEKKDKKKHKKHSKDKKKKKHKKEKKREKDKHKHKQ---EKESSDEETKDKESKNSSSP 239

Query: 399 VKLLISQ--------GFHEGNTQIWLPKVVAQSGTTK 485
K I++ + ++ PK +++ G+ K
Sbjct: 240 PKSAITREKDKSKIDSILDKPDELSTPKKISEKGSPK 276


>tr|Q8IK49|Q8IK49_PLAF7 Putative uncharacterized protein
OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0758 PE=4
SV=1
Length = 1263

Score = 35.0 bits (79), Expect = 2.2
Identities = 25/90 (27%), Positives = 44/90 (48%)
Frame = +3

Query: 222 STKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRMIPV 401
S++NK ++K N+ + K K + +K + KLD+ EK+ ++ IP
Sbjct: 637 SSQNKTNSQNKQNSQDKTNKQSKLDTQNGKNEKNEKSIPNKLDSQNGKNEKN--EKSIPN 694

Query: 402 KLLISQGFHEGNTQIWLPKVVAQSGTTKKN 491
KL G +E N + K+ +Q+G +KN
Sbjct: 695 KLDSQNGKNEKNEKSIPNKLDSQNGKNEKN 724



Score = 33.1 bits (74), Expect = 8.3
Identities = 35/118 (29%), Positives = 53/118 (44%), Gaps = 8/118 (6%)
Frame = +3

Query: 174 KKPKLIA*TYPSQPTCSTKNKIRYKHKTNNSNWRKKNHKRQKKRPSK--------QKMRQ 329
K K I SQ + KN+ +K ++ N KN K +K P+K +K +
Sbjct: 669 KNEKSIPNKLDSQNGKNEKNEKSIPNKLDSQNG--KNEKNEKSIPNKLDSQNGKNEKNEK 726

Query: 330 V*VPKLDASQVTQEKHVKQRMIPVKLLISQGFHEGNTQIWLPKVVAQSGTTKKNHVHK 503
KLD+ EK+ K IP KL G +E N + K+ +Q+G +KN +K
Sbjct: 727 SIPNKLDSQNGKNEKNEKS--IPNKLDSQNGKNEKNEKSIPNKLDSQNGKNEKNIPNK 782


>tr|Q23BX2|Q23BX2_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00227100 PE=4
SV=1
Length = 1318

Score = 35.0 bits (79), Expect = 2.2
Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 5/69 (7%)
Frame = +3

Query: 228 KNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRMI---- 395
K KI Y+ K+NN N RK+N+ ++K + + L+ SQ+ +EK+ KQ++
Sbjct: 946 KYKIVYERKSNNINERKQNNIDERKSNNMYDI-------LNQSQILEEKYEKQQVFNKAI 998

Query: 396 -PVKLLISQ 419
+ L+ISQ
Sbjct: 999 KNINLIISQ 1007


>tr|A7R151|A7R151_VITVI Chromosome undetermined scaffold_337, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00011778001 PE=4 SV=1
Length = 200

Score = 34.7 bits (78), Expect = 2.9
Identities = 18/62 (29%), Positives = 31/62 (50%)
Frame = +3

Query: 219 CSTKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRMIP 398
C K+RYK++ W KKN + P +QV VP+ S+ +EK ++ ++
Sbjct: 43 CLDHLKLRYKYQDIPIPWLKKNDHQNGGTPKDDDQQQVEVPRPKKSRSKKEKEDEEEVLL 102

Query: 399 VK 404
+K
Sbjct: 103 IK 104


>tr|Q8MPX4|Q8MPX4_CAEEL Putative uncharacterized protein
OS=Caenorhabditis elegans GN=spat-3 PE=2 SV=2
Length = 2471

Score = 34.7 bits (78), Expect = 2.9
Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 2/57 (3%)
Frame = +3

Query: 207 SQPTCSTKNKI--RYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQE 371
S+P+CST K R + + + N + N ++KKR K+K VPK D S V+ E
Sbjct: 374 SKPSCSTSKKTTNRSRDSSESDNDSRDNELQKKKRKMKRKN----VPKTDGSDVSNE 426


>tr|Q4Z2T9|Q4Z2T9_PLABE Putative uncharacterized protein (Fragment)
OS=Plasmodium berghei GN=PB102255.00.0 PE=4 SV=1
Length = 369

Score = 34.7 bits (78), Expect = 2.9
Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 3/100 (3%)
Frame = +3

Query: 222 STKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLD--ASQVTQEKHVKQRMI 395
ST +K YK+ NN N K + K++KK+ K M + + D A++ +K +
Sbjct: 97 STSSKFGYKNTLNNDNSSKSSEKKKKKKKMKNDMNGKVIKRNDNLANETIDKKKSASKN- 155

Query: 396 PVKLLISQGFHEGNTQIWLPKVVAQSGTTKKNHVH-KFLS 512
IS+ F+ I + + + TKKN+ H K LS
Sbjct: 156 -----ISKSFNLKKNNI-ISSNININSNTKKNYKHGKILS 189


>tr|B3L8M7|B3L8M7_PLAKH Putative uncharacterized protein
OS=Plasmodium knowlesi (strain H) GN=PKH_121730 PE=4
SV=1
Length = 385

Score = 34.3 bits (77), Expect = 3.7
Identities = 21/60 (35%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
Frame = +3

Query: 231 NKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VP--KLDASQVTQEKHVKQRMIPVK 404
+K+ K+K NN +++KN K + ++ SK++ ++ P K+ +VT EK V +RM+P K
Sbjct: 9 DKVFEKYKNNNL-YKRKNEKEEVEQGSKKEAKEKKAPEKKVTEKKVT-EKKVTERMVPEK 66


>tr|Q8I1N9|Q8I1N9_PLAF7 Putative uncharacterized protein PFD0970c
OS=Plasmodium falciparum (isolate 3D7) GN=PFD0970c PE=4
SV=1
Length = 3370

Score = 33.9 bits (76), Expect = 4.9
Identities = 24/94 (25%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
Frame = +3

Query: 228 KNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLD-ASQVTQEKHVKQRMIPVK 404
KN+ K K +NS +R N+ R+K+ +++ ++ K++ +V +EK V++ +
Sbjct: 2435 KNEKFLKKKNSNSKYRIYNNNREKEEKEEKEKKEEKEKKVEKEKKVEKEKKVEKEENKLN 2494

Query: 405 LLISQGFHEGNT-QIW-LPKVVAQSGTTKKNHVH 500
+S+ +H NT Q++ PK + + VH
Sbjct: 2495 DNLSETYHVNNTHQVFNTPKFNTKKDKSNNEQVH 2528


>tr|Q4XMB8|Q4XMB8_PLACH Putative uncharacterized protein (Fragment)
OS=Plasmodium chabaudi GN=PC108904.00.0 PE=4 SV=1
Length = 285

Score = 33.5 bits (75), Expect = 6.4
Identities = 16/55 (29%), Positives = 29/55 (52%)
Frame = +3

Query: 228 KNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRM 392
K K + + K +KK +++KKR +QK R+ K+ Q ++K K++M
Sbjct: 133 KKKRKKRQKKRQKRKKKKQKRKKKKRKKRQKKRKKRQKKMQKKQKKRQKRQKKKM 187



Score = 33.5 bits (75), Expect = 6.4
Identities = 18/54 (33%), Positives = 26/54 (48%)
Frame = +3

Query: 228 KNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQR 389
+ K++ K K +KK K QKKR +QK Q K+ Q +K K+R
Sbjct: 198 QKKMQKKQKKRQKRQKKKRKKGQKKRQKRQKKMQKRQKKMQKKQKKMQKKQKKR 251



Score = 33.1 bits (74), Expect = 8.3
Identities = 18/54 (33%), Positives = 27/54 (50%)
Frame = +3

Query: 228 KNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQR 389
K K + + K +KK KRQKKR ++K RQ K Q ++K K++
Sbjct: 46 KKKKQKRKKKKQKRQKKKRKKRQKKRQKRKKKRQKRKKKKQKRQKKKQKRKKKK 99


>tr|Q4N892|Q4N892_THEPA Putative uncharacterized protein
OS=Theileria parva GN=TP01_0578 PE=4 SV=1
Length = 668

Score = 33.5 bits (75), Expect = 6.4
Identities = 23/91 (25%), Positives = 48/91 (52%)
Frame = +3

Query: 117 SNKSITAQGYFQGNANVWAKKPKLIA*TYPSQPTCSTKNKIRYKHKTNNSNWRKKNHKRQ 296
S + I +Q + ++ K K+ T P++ + K+K + K K+++ + K+ +
Sbjct: 6 SRRRIESQSSMESSS---LKSSKVTKDTSPTKSKPTEKDKTKSKEKSSSKD---KDKSKT 59

Query: 297 KKRPSKQKMRQV*VPKLDASQVTQEKHVKQR 389
K++PSK+K ++ PKL ++K VK +
Sbjct: 60 KEKPSKEKEKE--EPKLKEKSPPKDKSVKSK 88