BP917255
Clone id YMU001_000098_C12
Library
Length 437
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000098_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATCTATCCAGACACTCGTCCGATTCTGAAGAGGCTCCAACCTTCAATTCTCTCCTCAAAG
AAGCTGCAATCTCATCACACTTTTGTAGTGTATTACCAATGAGATCTACTTCTGTCACTT
GAGAATCTAAATCAACGTACTGATCACCCTCATGTAGAAATGTGGCGTCCCCATCCATAC
AAATACCAGTTGCAAGATCTTGCTCTTCCTCTTCTTGAAGCAATCTAGGCTATAGCTTCA
TCATTAGATACTTTTTCATTCACTGCAGAAACATCATTCCATGGACTGTTGTCCCCATTT
TGCAATGCATCATGCCTTTCATAAGCTAGTGACTGGGGAGCTGAAGAACAAGCCTCCAGA
CTTGCAAGTCGAGCTTCTTTACGCTTCTGCACAATTGGATCAAAATCTTCATCGCTGCTT
TCGTCCAAGACCACATA
■■Homology search results ■■ -
sp_hit_id Q96DN5
Definition sp|Q96DN5|WDR67_HUMAN WD repeat-containing protein 67 OS=Homo sapiens
Align length 65
Score (bit) 29.3
E-value 7.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917255|Adiantum capillus-veneris mRNA, clone:
YMU001_000098_C12.
(437 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q96DN5|WDR67_HUMAN WD repeat-containing protein 67 OS=Homo sa... 29 7.5
sp|Q9XYD3|HBL1_CAEEL Hunchback-like protein OS=Caenorhabditis el... 29 9.8

>sp|Q96DN5|WDR67_HUMAN WD repeat-containing protein 67 OS=Homo
sapiens GN=WDR67 PE=2 SV=2
Length = 1066

Score = 29.3 bits (64), Expect = 7.5
Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 3/65 (4%)
Frame = -2

Query: 190 TGICM-DGDATFLHEGDQYVDLDSQVTEVDLIGNTLQKCDEIAASLRR--ELKVGASSES 20
TG C+ GD H+G+ YV D +L+ T Q C +A +LRR E V + S
Sbjct: 53 TGDCLIAGD----HQGNIYV-FDLHGNRFNLVQRTAQACTALAFNLRRKSEFLVALADYS 107

Query: 19 DECLD 5
+C D
Sbjct: 108 IKCFD 112


>sp|Q9XYD3|HBL1_CAEEL Hunchback-like protein OS=Caenorhabditis
elegans GN=hbl-1 PE=2 SV=1
Length = 982

Score = 28.9 bits (63), Expect = 9.8
Identities = 16/56 (28%), Positives = 31/56 (55%)
Frame = -1

Query: 422 ESSDEDFDPIVQKRKEARLASLEACSSAPQSLAYERHDALQNGDNSPWNDVSAVNE 255
E D+ D V ++++S + + +SL+ E+ A NG+NSP ++ SA+ +
Sbjct: 811 EEMDQGSDSAVSPTGSSQISSGDEETKKCKSLSLEQISARANGNNSPMSNDSAMEK 866


tr_hit_id A9TL73
Definition tr|A9TL73|A9TL73_PHYPA SNF2 family DNA-dependent ATPase OS=Physcomitrella patens subsp. patens
Align length 42
Score (bit) 39.3
E-value 0.099
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917255|Adiantum capillus-veneris mRNA, clone:
YMU001_000098_C12.
(437 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TL73|A9TL73_PHYPA SNF2 family DNA-dependent ATPase OS=Physc... 39 0.099
tr|A7QBW6|A7QBW6_VITVI Chromosome chr1 scaffold_75, whole genome... 35 1.4
tr|A9TLP8|A9TLP8_PHYPA SNF2 family DNA-dependent ATPase OS=Physc... 33 5.4
tr|A6QW42|A6QW42_AJECN Predicted protein OS=Ajellomyces capsulat... 33 5.4
tr|A9AW13|A9AW13_HERA2 FolC bifunctional protein OS=Herpetosipho... 33 7.1
tr|Q5SEK6|Q5SEK6_PLARE Erythrocyte invasion ligand JSEBL/EBA-181... 33 7.1

>tr|A9TL73|A9TL73_PHYPA SNF2 family DNA-dependent ATPase
OS=Physcomitrella patens subsp. patens GN=CHR1506 PE=4
SV=1
Length = 719

Score = 39.3 bits (90), Expect = 0.099
Identities = 20/42 (47%), Positives = 29/42 (69%)
Frame = -2

Query: 127 DSQVTEVDLIGNTLQKCDEIAASLRRELKVGASSESDECLDR 2
+ + EV+ I TLQ+CD+IAASLR EL+ +SS++ DR
Sbjct: 82 EEEEEEVNPITITLQRCDQIAASLREELQASSSSDNSVNEDR 123


>tr|A7QBW6|A7QBW6_VITVI Chromosome chr1 scaffold_75, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00035134001
PE=4 SV=1
Length = 386

Score = 35.4 bits (80), Expect = 1.4
Identities = 15/30 (50%), Positives = 22/30 (73%)
Frame = -2

Query: 133 DLDSQVTEVDLIGNTLQKCDEIAASLRREL 44
+ + +V E D++G LQKC +I+A LRREL
Sbjct: 107 EAEEEVEEDDVVGKALQKCAKISAELRREL 136


>tr|A9TLP8|A9TLP8_PHYPA SNF2 family DNA-dependent ATPase
OS=Physcomitrella patens subsp. patens GN=CHR1507 PE=4
SV=1
Length = 631

Score = 33.5 bits (75), Expect = 5.4
Identities = 16/30 (53%), Positives = 21/30 (70%)
Frame = -2

Query: 91 TLQKCDEIAASLRRELKVGASSESDECLDR 2
TLQKC IAASL+ ELK ++S+ +DR
Sbjct: 3 TLQKCHRIAASLKSELKATSTSDDAVSVDR 32


>tr|A6QW42|A6QW42_AJECN Predicted protein OS=Ajellomyces capsulata
(strain NAm1 / WU24) GN=HCAG_01599 PE=4 SV=1
Length = 827

Score = 33.5 bits (75), Expect = 5.4
Identities = 12/28 (42%), Positives = 22/28 (78%)
Frame = +3

Query: 348 TSLQTCKSSFFTLLHNWIKIFIAAFVQD 431
TSL+TCK F++ +H+ +K+++AA +D
Sbjct: 737 TSLRTCKEKFYSSVHDSLKLWVAAAAED 764


>tr|A9AW13|A9AW13_HERA2 FolC bifunctional protein OS=Herpetosiphon
aurantiacus (strain ATCC 23779 / DSM 785) GN=Haur_0603
PE=4 SV=1
Length = 435

Score = 33.1 bits (74), Expect = 7.1
Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
Frame = -1

Query: 434 VVLDESSDEDFDPIVQKRKEARLASLEACSSAPQSLAYER-HDALQNGDNSPWNDVSAVN 258
+VL SSD+D I+Q+ + + CS P++LA E+ + +Q N P + ++V
Sbjct: 338 LVLGTSSDKDIQAIIQQLSNSATHLITTCSRHPRALAPEKLAELIQQHVNRPVHQTNSVA 397

Query: 257 EKVS 246
E ++
Sbjct: 398 EALT 401


>tr|Q5SEK6|Q5SEK6_PLARE Erythrocyte invasion ligand JSEBL/EBA-181
(Fragment) OS=Plasmodium reichenowi PE=4 SV=1
Length = 1497

Score = 33.1 bits (74), Expect = 7.1
Identities = 16/61 (26%), Positives = 34/61 (55%), Gaps = 3/61 (4%)
Frame = -1

Query: 425 DESSDEDFDPI---VQKRKEARLASLEACSSAPQSLAYERHDALQNGDNSPWNDVSAVNE 255
+++ ++DFDP+ ++K + L +LE A + HD++ +GDN N+ + +E
Sbjct: 1260 EQNEEKDFDPVESDLEKEEIKNLLNLEKEEDADVEIIDRTHDSMSDGDNGDSNNNNLSSE 1319

Query: 254 K 252
+
Sbjct: 1320 E 1320