BP917265
Clone id YMU001_000098_E04
Library
Length 416
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000098_E04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAAAGAGAAGTTTTTCTATTCAAGCTACACTTTCTGGTGAGGATCCCTCACCGATATCAC
AAAGCGCCTGATCATCCTCATCATCATCATAATCATACAAAGCAACAGAGTCATTGACAT
CTGTGTCAGTCTCCCTCCTCACAAACTGACCCTTAATACGAGGTCGCTGCTCAGCCAGCT
ATCTTTCGACCCGAGTACCCAATTTTCTTCTCGAAGCAACGGTCCTTGCGCTTGAGACGG
AACTTGTTCAAAGCAACCTCTCTTCTCTCTGCTTGTCCAAGCTTCCTCTCAAGTATCGGA
CTTGGCACAGCAGGATGCCATCCAGGACATGAGCCAAGCTGGGATGAAGCAGCCATATGT
AACCCAAAGGGGTGAAACAAAAAAGTACCAGTTAAATTCAAGCCCTGAGGCATATG
■■Homology search results ■■ -
sp_hit_id Q689G9
Definition sp|Q689G9|PRR1_ORYSJ Two-component response regulator-like PRR1 OS=Oryza sativa subsp. japonica
Align length 74
Score (bit) 60.1
E-value 9.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917265|Adiantum capillus-veneris mRNA, clone:
YMU001_000098_E04.
(416 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q689G9|PRR1_ORYSJ Two-component response regulator-like PRR1 ... 60 9e-13
sp|Q689G6|PRR95_ORYSJ Two-component response regulator-like PRR9... 52 3e-10
sp|Q6LA42|APRR5_ARATH Two-component response regulator-like APRR... 49 1e-09
sp|Q9LKL2|APRR1_ARATH Two-component response regulator-like APRR... 49 3e-09
sp|Q8L500|APRR9_ARATH Two-component response regulator-like APRR... 46 2e-08
sp|Q9LVG4|APRR3_ARATH Two-component response regulator-like APRR... 45 3e-08
sp|Q93WK5|APRR7_ARATH Two-component response regulator-like APRR... 43 7e-08
sp|Q10N34|PRR73_ORYSJ Two-component response regulator-like PRR7... 37 7e-06
sp|A2XFB7|PRR73_ORYSI Two-component response regulator-like PRR7... 37 7e-06
sp|Q0D3B6|PRR37_ORYSJ Two-component response regulator-like PRR3... 36 4e-05
sp|A2YQ93|PRR37_ORYSI Two-component response regulator-like PRR3... 36 4e-05
sp|Q940T9|COL4_ARATH Zinc finger protein CONSTANS-LIKE 4 OS=Arab... 34 2e-04
sp|Q9M9B3|COL8_ARATH Putative zinc finger protein CONSTANS-LIKE ... 34 6e-04
sp|Q9SK53|COL3_ARATH Zinc finger protein CONSTANS-LIKE 3 OS=Arab... 31 0.003
sp|Q9FHH8|COL5_ARATH Zinc finger protein CONSTANS-LIKE 5 OS=Arab... 30 0.006
sp|Q9C9A9|COL7_ARATH Zinc finger protein CONSTANS-LIKE 7 OS=Arab... 30 0.007
sp|Q8LG76|COL6_ARATH Zinc finger protein CONSTANS-LIKE 6 OS=Arab... 30 0.010
sp|Q8RWD0|COL16_ARATH Zinc finger protein CONSTANS-LIKE 16 OS=Ar... 30 0.012
sp|Q39057|CONS_ARATH Zinc finger protein CONSTANS OS=Arabidopsis... 31 0.027
sp|O50055|COL1_ARATH Zinc finger protein CONSTANS-LIKE 1 OS=Arab... 28 0.12
sp|Q96502|COL2_ARATH Zinc finger protein CONSTANS-LIKE 2 OS=Arab... 27 0.20
sp|Q9LRH6|GAT26_ARATH GATA transcription factor 26 OS=Arabidopsi... 33 0.45
sp|Q9SSE5|COL9_ARATH Zinc finger protein CONSTANS-LIKE 9 OS=Arab... 32 1.3
sp|Q93033|IGSF2_HUMAN Immunoglobulin superfamily member 2 OS=Hom... 31 2.2
sp|O82256|COL13_ARATH Zinc finger protein CONSTANS-LIKE 13 OS=Ar... 31 2.2
sp|Q70KP1|HEMA_PTV10 Hemagglutinin-esterase OS=Porcine torovirus... 30 2.9
sp|Q8H1G0|GAT25_ARATH GATA transcription factor 25 OS=Arabidopsi... 30 3.8
sp|A2QSG6|SEC24_ASPNC Protein transport protein sec24 OS=Aspergi... 29 6.4
sp|Q9H0J4|QRIC2_HUMAN Glutamine-rich protein 2 OS=Homo sapiens G... 29 6.4
sp|Q4PA36|MON1_USTMA Vacuolar fusion protein MON1 OS=Ustilago ma... 29 8.4

>sp|Q689G9|PRR1_ORYSJ Two-component response regulator-like PRR1
OS=Oryza sativa subsp. japonica GN=PRR1 PE=2 SV=2
Length = 518

Score = 60.1 bits (144), Expect(2) = 9e-13
Identities = 31/74 (41%), Positives = 47/74 (63%)
Frame = -1

Query: 404 GLNLTGTFLFHPFGLHMAASSQLGSCPGWHPAVPSPILERKLGQAERREVALNKFRLKRK 225
G+++ F ++P G+ + S+QL + W A +P+ E ++ERR AL KFRLKRK
Sbjct: 397 GVSMMPPFQYNPAGMSIQ-SNQLPTQNMWPQASSTPMPEETCSRSERRAAALAKFRLKRK 455

Query: 224 DRCFEKKIGYSGRK 183
+RCF+KK+ Y RK
Sbjct: 456 ERCFDKKVRYVNRK 469



Score = 32.3 bits (72), Expect(2) = 9e-13
Identities = 13/24 (54%), Positives = 18/24 (75%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRETDTDVNDS 107
LAE RPR++GQFVR+ TD+ +
Sbjct: 471 LAETRPRVRGQFVRQANYTDITST 494


>sp|Q689G6|PRR95_ORYSJ Two-component response regulator-like PRR95
OS=Oryza sativa subsp. japonica GN=PRR95 PE=2 SV=1
Length = 623

Score = 51.6 bits (122), Expect(2) = 3e-10
Identities = 23/34 (67%), Positives = 26/34 (76%)
Frame = -1

Query: 281 LGQAERREVALNKFRLKRKDRCFEKKIGYSGRKI 180
L +RE ALNKFRLKRKDRCFEKK+ Y RK+
Sbjct: 568 LRHLSQREAALNKFRLKRKDRCFEKKVRYQSRKL 601



Score = 32.3 bits (72), Expect(2) = 3e-10
Identities = 13/16 (81%), Positives = 16/16 (100%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRE 131
LAEQRPR+KGQFVR++
Sbjct: 602 LAEQRPRVKGQFVRQD 617


>sp|Q6LA42|APRR5_ARATH Two-component response regulator-like APRR5
OS=Arabidopsis thaliana GN=APRR5 PE=1 SV=2
Length = 558

Score = 49.3 bits (116), Expect(2) = 1e-09
Identities = 21/34 (61%), Positives = 27/34 (79%)
Frame = -1

Query: 284 KLGQAERREVALNKFRLKRKDRCFEKKIGYSGRK 183
K+ Q+ +RE AL KFR+KRKDRC+EKK+ Y RK
Sbjct: 502 KIQQSLQREAALTKFRMKRKDRCYEKKVRYESRK 535



Score = 32.7 bits (73), Expect(2) = 1e-09
Identities = 15/19 (78%), Positives = 16/19 (84%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRETDT 122
LAEQRPRIKGQFVR+ T
Sbjct: 537 LAEQRPRIKGQFVRQVQST 555


>sp|Q9LKL2|APRR1_ARATH Two-component response regulator-like APRR1
OS=Arabidopsis thaliana GN=APRR1 PE=1 SV=1
Length = 618

Score = 48.9 bits (115), Expect(2) = 3e-09
Identities = 24/46 (52%), Positives = 29/46 (63%)
Frame = -1

Query: 320 WHPAVPSPILERKLGQAERREVALNKFRLKRKDRCFEKKIGYSGRK 183
W PA P E ++ + +RRE AL KFR KR RCF+KKI Y RK
Sbjct: 514 WSPAGNPPSNEVRVNKLDRREEALLKFRRKRNQRCFDKKIRYVNRK 559



Score = 31.6 bits (70), Expect(2) = 3e-09
Identities = 13/22 (59%), Positives = 18/22 (81%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRETDTDVN 113
LAE+RPR+KGQFVR+ +V+
Sbjct: 561 LAERRPRVKGQFVRKMNGVNVD 582


>sp|Q8L500|APRR9_ARATH Two-component response regulator-like APRR9
OS=Arabidopsis thaliana GN=APRR9 PE=2 SV=2
Length = 468

Score = 46.2 bits (108), Expect(2) = 2e-08
Identities = 20/28 (71%), Positives = 23/28 (82%)
Frame = -1

Query: 266 RREVALNKFRLKRKDRCFEKKIGYSGRK 183
+RE AL KFRLKRKDRCF+KK+ Y RK
Sbjct: 416 QREAALMKFRLKRKDRCFDKKVRYQSRK 443



Score = 31.2 bits (69), Expect(2) = 2e-08
Identities = 13/14 (92%), Positives = 14/14 (100%)
Frame = -2

Query: 178 LAEQRPRIKGQFVR 137
LAEQRPR+KGQFVR
Sbjct: 445 LAEQRPRVKGQFVR 458


>sp|Q9LVG4|APRR3_ARATH Two-component response regulator-like APRR3
OS=Arabidopsis thaliana GN=APRR3 PE=1 SV=1
Length = 495

Score = 45.4 bits (106), Expect(2) = 3e-08
Identities = 20/28 (71%), Positives = 23/28 (82%)
Frame = -1

Query: 266 RREVALNKFRLKRKDRCFEKKIGYSGRK 183
+RE AL KFRLKRK+RCFEKK+ Y RK
Sbjct: 441 QREAALMKFRLKRKERCFEKKVRYHSRK 468



Score = 31.6 bits (70), Expect(2) = 3e-08
Identities = 12/18 (66%), Positives = 15/18 (83%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRETD 125
LAEQRP +KGQF+R+ D
Sbjct: 470 LAEQRPHVKGQFIRKRDD 487


>sp|Q93WK5|APRR7_ARATH Two-component response regulator-like APRR7
OS=Arabidopsis thaliana GN=APRR7 PE=2 SV=1
Length = 727

Score = 43.1 bits (100), Expect(2) = 7e-08
Identities = 21/36 (58%), Positives = 24/36 (66%)
Frame = -1

Query: 290 ERKLGQAERREVALNKFRLKRKDRCFEKKIGYSGRK 183
E K+ Q RE AL KFR KRK+RCF KK+ Y RK
Sbjct: 663 ENKISQ---REAALTKFRQKRKERCFRKKVRYQSRK 695



Score = 32.7 bits (73), Expect(2) = 7e-08
Identities = 16/24 (66%), Positives = 19/24 (79%), Gaps = 1/24 (4%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRR-ETDTDVND 110
LAEQRPR++GQFVR+ TD ND
Sbjct: 697 LAEQRPRVRGQFVRKTAAATDDND 720


>sp|Q10N34|PRR73_ORYSJ Two-component response regulator-like PRR73
OS=Oryza sativa subsp. japonica GN=PRR73 PE=2 SV=1
Length = 767

Score = 37.0 bits (84), Expect(2) = 7e-06
Identities = 18/27 (66%), Positives = 19/27 (70%)
Frame = -1

Query: 263 REVALNKFRLKRKDRCFEKKIGYSGRK 183
RE ALNKFR KRK R F KK+ Y RK
Sbjct: 712 REAALNKFRQKRKVRNFGKKVRYQSRK 738



Score = 32.0 bits (71), Expect(2) = 7e-06
Identities = 14/20 (70%), Positives = 16/20 (80%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRETDTD 119
LAEQRPRI+GQFVR+ D
Sbjct: 740 LAEQRPRIRGQFVRQSGQED 759


>sp|A2XFB7|PRR73_ORYSI Two-component response regulator-like PRR73
OS=Oryza sativa subsp. indica GN=PRR73 PE=2 SV=2
Length = 767

Score = 37.0 bits (84), Expect(2) = 7e-06
Identities = 18/27 (66%), Positives = 19/27 (70%)
Frame = -1

Query: 263 REVALNKFRLKRKDRCFEKKIGYSGRK 183
RE ALNKFR KRK R F KK+ Y RK
Sbjct: 712 REAALNKFRQKRKVRNFGKKVRYQSRK 738



Score = 32.0 bits (71), Expect(2) = 7e-06
Identities = 14/20 (70%), Positives = 16/20 (80%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRETDTD 119
LAEQRPRI+GQFVR+ D
Sbjct: 740 LAEQRPRIRGQFVRQSGQED 759


>sp|Q0D3B6|PRR37_ORYSJ Two-component response regulator-like PRR37
OS=Oryza sativa subsp. japonica GN=PRR37 PE=2 SV=1
Length = 742

Score = 35.8 bits (81), Expect(2) = 4e-05
Identities = 17/35 (48%), Positives = 22/35 (62%)
Frame = -1

Query: 287 RKLGQAERREVALNKFRLKRKDRCFEKKIGYSGRK 183
++ Q E R A+ KFR KRK+R F KK+ Y RK
Sbjct: 674 KRFTQREHRVAAVIKFRQKRKERNFGKKVRYQSRK 708



Score = 30.4 bits (67), Expect(2) = 4e-05
Identities = 12/15 (80%), Positives = 15/15 (100%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRR 134
LAEQRPR++GQFVR+
Sbjct: 710 LAEQRPRVRGQFVRQ 724


tr_hit_id Q0DZH6
Definition tr|Q0DZH6|Q0DZH6_ORYSJ Os02g0618200 protein OS=Oryza sativa subsp. japonica
Align length 74
Score (bit) 60.1
E-value 1.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917265|Adiantum capillus-veneris mRNA, clone:
YMU001_000098_E04.
(416 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q0DZH6|Q0DZH6_ORYSJ Os02g0618200 protein OS=Oryza sativa subs... 60 1e-11
tr|B8AFH0|B8AFH0_ORYSI Putative uncharacterized protein OS=Oryza... 60 1e-11
tr|A3A941|A3A941_ORYSJ Putative uncharacterized protein OS=Oryza... 60 1e-11
tr|B6SVD1|B6SVD1_MAIZE Two-component response regulator-like PRR... 57 1e-10
tr|B4FWH6|B4FWH6_MAIZE Putative uncharacterized protein OS=Zea m... 54 8e-10
tr|B6U1H8|B6U1H8_MAIZE Two-component response regulator-like PRR... 53 1e-09
tr|Q84XQ7|Q84XQ7_BRARP Timing of CAB expression 1-like protein (... 51 1e-09
tr|A3C0X1|A3C0X1_ORYSJ Putative uncharacterized protein OS=Oryza... 52 4e-09
tr|Q0J041|Q0J041_ORYSJ Os09g0532400 protein OS=Oryza sativa subs... 52 4e-09
tr|B8BDU3|B8BDU3_ORYSI Putative uncharacterized protein OS=Oryza... 52 4e-09
tr|A7PDI6|A7PDI6_VITVI Chromosome chr17 scaffold_12, whole genom... 54 4e-09
tr|A5BJJ5|A5BJJ5_VITVI Putative uncharacterized protein OS=Vitis... 47 1e-08
tr|A7PXT9|A7PXT9_VITVI Chromosome chr15 scaffold_37, whole genom... 47 1e-08
tr|Q56TL2|Q56TL2_CASSA Timing of CAB expression 1 protein OS=Cas... 51 2e-08
tr|Q2PEF3|Q2PEF3_LEMGI Pseudo-response regulator 59 homologue OS... 47 2e-08
tr|Q2PEF2|Q2PEF2_LEMGI Pseudo-response regulator 95 homologue OS... 49 3e-08
tr|Q2PEF5|Q2PEF5_9ARAE Pseudo-response regulator 95 homologue OS... 49 4e-08
tr|A7Q402|A7Q402_VITVI Chromosome chr13 scaffold_48, whole genom... 47 6e-08
tr|A7QEV3|A7QEV3_VITVI Chromosome chr16 scaffold_86, whole genom... 48 6e-08
tr|Q2RAB7|Q2RAB7_ORYSJ CCT motif family protein, expressed OS=Or... 49 1e-07
tr|Q0IUG8|Q0IUG8_ORYSJ Os11g0157600 protein OS=Oryza sativa subs... 49 1e-07
tr|B8BJ76|B8BJ76_ORYSI Putative uncharacterized protein OS=Oryza... 49 1e-07
tr|Q2PEF6|Q2PEF6_9ARAE Pseudo-response regulator 59 homologue OS... 47 1e-07
tr|Q6UEI7|Q6UEI7_MESCR Timing of CAB expression 1 OS=Mesembryant... 49 2e-07
tr|Q56XM1|Q56XM1_ARATH Putative uncharacterized protein At2g4679... 46 3e-07
tr|Q683A6|Q683A6_ARATH Putative uncharacterized protein At2g4679... 46 3e-07
tr|Q3EBF0|Q3EBF0_ARATH Uncharacterized protein At2g46670.1 OS=Ar... 46 3e-07
tr|Q4PRK6|Q4PRK6_ARATH Pseudo response regulator 3 OS=Arabidopsi... 45 4e-07
tr|Q4PRK5|Q4PRK5_ARATH Pseudo response regulator 3 OS=Arabidopsi... 45 4e-07
tr|B8A2Q1|B8A2Q1_MAIZE Putative uncharacterized protein OS=Zea m... 43 1e-06

>tr|Q0DZH6|Q0DZH6_ORYSJ Os02g0618200 protein OS=Oryza sativa subsp.
japonica GN=Os02g0618200 PE=4 SV=1
Length = 518

Score = 60.1 bits (144), Expect(2) = 1e-11
Identities = 31/74 (41%), Positives = 47/74 (63%)
Frame = -1

Query: 404 GLNLTGTFLFHPFGLHMAASSQLGSCPGWHPAVPSPILERKLGQAERREVALNKFRLKRK 225
G+++ F ++P G+ + S+QL + W A +P+ E ++ERR AL KFRLKRK
Sbjct: 397 GVSMMPPFQYNPAGMSIQ-SNQLPTQNMWPQASSTPMPEETCSRSERRAAALAKFRLKRK 455

Query: 224 DRCFEKKIGYSGRK 183
+RCF+KK+ Y RK
Sbjct: 456 ERCFDKKVRYVNRK 469



Score = 32.3 bits (72), Expect(2) = 1e-11
Identities = 13/24 (54%), Positives = 18/24 (75%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRETDTDVNDS 107
LAE RPR++GQFVR+ TD+ +
Sbjct: 471 LAETRPRVRGQFVRQANYTDITST 494


>tr|B8AFH0|B8AFH0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_08092 PE=4 SV=1
Length = 518

Score = 60.1 bits (144), Expect(2) = 1e-11
Identities = 31/74 (41%), Positives = 47/74 (63%)
Frame = -1

Query: 404 GLNLTGTFLFHPFGLHMAASSQLGSCPGWHPAVPSPILERKLGQAERREVALNKFRLKRK 225
G+++ F ++P G+ + S+QL + W A +P+ E ++ERR AL KFRLKRK
Sbjct: 397 GVSMMPPFQYNPAGMSIQ-SNQLPTQNMWPQASSTPMPEETCSRSERRAAALAKFRLKRK 455

Query: 224 DRCFEKKIGYSGRK 183
+RCF+KK+ Y RK
Sbjct: 456 ERCFDKKVRYVNRK 469



Score = 32.3 bits (72), Expect(2) = 1e-11
Identities = 13/24 (54%), Positives = 18/24 (75%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRETDTDVNDS 107
LAE RPR++GQFVR+ TD+ +
Sbjct: 471 LAETRPRVRGQFVRQANYTDITST 494


>tr|A3A941|A3A941_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_007313 PE=4 SV=1
Length = 494

Score = 60.1 bits (144), Expect(2) = 1e-11
Identities = 31/74 (41%), Positives = 47/74 (63%)
Frame = -1

Query: 404 GLNLTGTFLFHPFGLHMAASSQLGSCPGWHPAVPSPILERKLGQAERREVALNKFRLKRK 225
G+++ F ++P G+ + S+QL + W A +P+ E ++ERR AL KFRLKRK
Sbjct: 373 GVSMMPPFQYNPAGMSIQ-SNQLPTQNMWPQASSTPMPEETCSRSERRAAALAKFRLKRK 431

Query: 224 DRCFEKKIGYSGRK 183
+RCF+KK+ Y RK
Sbjct: 432 ERCFDKKVRYVNRK 445



Score = 32.3 bits (72), Expect(2) = 1e-11
Identities = 13/24 (54%), Positives = 18/24 (75%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRETDTDVNDS 107
LAE RPR++GQFVR+ TD+ +
Sbjct: 447 LAETRPRVRGQFVRQANYTDITST 470


>tr|B6SVD1|B6SVD1_MAIZE Two-component response regulator-like PRR1
OS=Zea mays PE=2 SV=1
Length = 515

Score = 56.6 bits (135), Expect(2) = 1e-10
Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
Frame = -1

Query: 404 GLNLTGTFLFHPFGLHMAASSQLGSCPGWHPAVPSP-ILERKLGQAERREVALNKFRLKR 228
GL + +F F+P G+ SS L + W A +P + E ++ERR AL KFRLKR
Sbjct: 393 GLPVIPSFQFNPSGMS-THSSHLPTQNVWSSASSTPPVPEETCSRSERRAAALAKFRLKR 451

Query: 227 KDRCFEKKIGYSGRK 183
K+RCF+KK+ Y RK
Sbjct: 452 KERCFDKKVRYVNRK 466



Score = 32.7 bits (73), Expect(2) = 1e-10
Identities = 14/21 (66%), Positives = 18/21 (85%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRETDTDV 116
LAE R R++GQFVR+ T+TDV
Sbjct: 468 LAETRARVRGQFVRQPTNTDV 488


>tr|B4FWH6|B4FWH6_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 629

Score = 53.9 bits (128), Expect(2) = 8e-10
Identities = 28/45 (62%), Positives = 30/45 (66%)
Frame = -1

Query: 314 PAVPSPILERKLGQAERREVALNKFRLKRKDRCFEKKIGYSGRKI 180
P PS R L Q RE ALNKFRLKRKDRCFEKK+ Y RK+
Sbjct: 566 PETPSAEGSRHLSQ---REAALNKFRLKRKDRCFEKKVRYQSRKL 607



Score = 32.3 bits (72), Expect(2) = 8e-10
Identities = 13/16 (81%), Positives = 16/16 (100%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRE 131
LAEQRPR+KGQFVR++
Sbjct: 608 LAEQRPRVKGQFVRQD 623


>tr|B6U1H8|B6U1H8_MAIZE Two-component response regulator-like PRR95
OS=Zea mays PE=2 SV=1
Length = 630

Score = 53.1 bits (126), Expect(2) = 1e-09
Identities = 25/43 (58%), Positives = 28/43 (65%)
Frame = -1

Query: 308 VPSPILERKLGQAERREVALNKFRLKRKDRCFEKKIGYSGRKI 180
VP L +RE ALNKFRLKRKDRCFEKK+ Y RK+
Sbjct: 566 VPETARAEGLRHLSQREAALNKFRLKRKDRCFEKKVRYQSRKL 608



Score = 32.3 bits (72), Expect(2) = 1e-09
Identities = 13/16 (81%), Positives = 16/16 (100%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRE 131
LAEQRPR+KGQFVR++
Sbjct: 609 LAEQRPRVKGQFVRQD 624


>tr|Q84XQ7|Q84XQ7_BRARP Timing of CAB expression 1-like protein
(Fragment) OS=Brassica rapa subsp. pekinensis PE=2 SV=1
Length = 104

Score = 51.2 bits (121), Expect(2) = 1e-09
Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 6/72 (8%)
Frame = -1

Query: 380 LFHPFGLHMAASSQLG-SCPGWHPAVPSPILER-----KLGQAERREVALNKFRLKRKDR 219
+FHPF M A + S H A+ + + Q+ +RE ALNKFR+KRKDR
Sbjct: 4 MFHPFNGSMDAEERRHISSTTEHSAIDNHCSANSSSVGRTQQSLQREAALNKFRMKRKDR 63

Query: 218 CFEKKIGYSGRK 183
CF+KK+ Y RK
Sbjct: 64 CFDKKVRYESRK 75



Score = 34.3 bits (77), Expect(2) = 1e-09
Identities = 16/26 (61%), Positives = 19/26 (73%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRETDTDVNDSVA 101
LAEQRPRIKGQFVR+ T+ + A
Sbjct: 77 LAEQRPRIKGQFVRQVQSTETSTQEA 102


>tr|A3C0X1|A3C0X1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_028943 PE=4 SV=1
Length = 665

Score = 51.6 bits (122), Expect(2) = 4e-09
Identities = 23/34 (67%), Positives = 26/34 (76%)
Frame = -1

Query: 281 LGQAERREVALNKFRLKRKDRCFEKKIGYSGRKI 180
L +RE ALNKFRLKRKDRCFEKK+ Y RK+
Sbjct: 610 LRHLSQREAALNKFRLKRKDRCFEKKVRYQSRKL 643



Score = 32.3 bits (72), Expect(2) = 4e-09
Identities = 13/16 (81%), Positives = 16/16 (100%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRE 131
LAEQRPR+KGQFVR++
Sbjct: 644 LAEQRPRVKGQFVRQD 659


>tr|Q0J041|Q0J041_ORYSJ Os09g0532400 protein OS=Oryza sativa subsp.
japonica GN=Os09g0532400 PE=2 SV=1
Length = 623

Score = 51.6 bits (122), Expect(2) = 4e-09
Identities = 23/34 (67%), Positives = 26/34 (76%)
Frame = -1

Query: 281 LGQAERREVALNKFRLKRKDRCFEKKIGYSGRKI 180
L +RE ALNKFRLKRKDRCFEKK+ Y RK+
Sbjct: 568 LRHLSQREAALNKFRLKRKDRCFEKKVRYQSRKL 601



Score = 32.3 bits (72), Expect(2) = 4e-09
Identities = 13/16 (81%), Positives = 16/16 (100%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRE 131
LAEQRPR+KGQFVR++
Sbjct: 602 LAEQRPRVKGQFVRQD 617


>tr|B8BDU3|B8BDU3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_32150 PE=4 SV=1
Length = 623

Score = 51.6 bits (122), Expect(2) = 4e-09
Identities = 23/34 (67%), Positives = 26/34 (76%)
Frame = -1

Query: 281 LGQAERREVALNKFRLKRKDRCFEKKIGYSGRKI 180
L +RE ALNKFRLKRKDRCFEKK+ Y RK+
Sbjct: 568 LRHLSQREAALNKFRLKRKDRCFEKKVRYQSRKL 601



Score = 32.3 bits (72), Expect(2) = 4e-09
Identities = 13/16 (81%), Positives = 16/16 (100%)
Frame = -2

Query: 178 LAEQRPRIKGQFVRRE 131
LAEQRPR+KGQFVR++
Sbjct: 602 LAEQRPRVKGQFVRQD 617