BP917267
Clone id YMU001_000098_E07
Library
Length 550
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000098_E07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAGAGCGGATACTGAAGTCAGTCATGGAGACAATGCCATCGGATGTAAGGTCCAGTGTCT
TGCATGTGCAAGGCAGAGAACGTATTTGCAAGGAGTTGCAGGCAAAGTTCAATGCTGCTC
TGCCATCCCAGCGAATTGCAAGCACTAAAGTGCTTGGCATGTTTGGTATTGGAGGAGCAG
GCAAGAGCACAGCATGTATGCTGATTACGGAATCCATGAGGAAGGCATTTTCTGGCAGAG
TTTGTCATGTAGAATTTAAACCAGATACTAGCACATTGAAACTACAATGCACAGTGCTCA
GGGAGCTCATCAGAGACAATGAAGTTTTTCTTGACAGGCATATGACTAATGAGCATAAGG
TGGGATAATGCGAAATGTCTCTCTTTCTAGTTCTTAATCAAGAATGGGCTTCACTGGTTT
GGGCAAAAGGTCTTAGGCTATCAAAGGAATGACTAAAACATTTACAGAAGTGAACAAAGA
GCCTGGCAGAAAGCCTGCATGATAATCATTCTGCCTGATTGCTGGTTGCTGTTTTATGTG
GAGAAAGCTT
■■Homology search results ■■ -
sp_hit_id P42490
Definition sp|P42490|KTHY_ASFB7 Thymidylate kinase OS=African swine fever virus (strain Badajoz 1971 Vero-adapted)
Align length 95
Score (bit) 34.7
E-value 0.31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917267|Adiantum capillus-veneris mRNA, clone:
YMU001_000098_E07.
(550 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P42490|KTHY_ASFB7 Thymidylate kinase OS=African swine fever v... 35 0.31
sp|P0C8G2|KTHY_ASFWA Thymidylate kinase OS=African swine fever v... 33 0.91
sp|P25941|AFSR_STRCO Regulatory protein afsR OS=Streptomyces coe... 32 1.5
sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47... 31 3.4
sp|P18770|CYAB_BORPE Cyclolysin secretion/processing ATP-binding... 31 3.4
sp|P11641|Y32K_MCMV Uncharacterized 32.7 kDa protein OS=Maize ch... 31 4.5
sp|Q8BUR4|DOCK1_MOUSE Dedicator of cytokinesis protein 1 OS=Mus ... 31 4.5
sp|Q9CP98|RBSA1_PASMU Ribose import ATP-binding protein rbsA 1 O... 30 5.9
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania t... 30 5.9
sp|Q65WJ1|ARAG_MANSM Arabinose import ATP-binding protein araG O... 30 5.9
sp|Q58DD9|GPN2_BOVIN GPN-loop GTPase 2 OS=Bos taurus GN=GPN2 PE=... 30 7.7
sp|Q779J8|DPOL_SFAVA DNA polymerase OS=Spodoptera frugiperda asc... 30 7.7

>sp|P42490|KTHY_ASFB7 Thymidylate kinase OS=African swine fever
virus (strain Badajoz 1971 Vero-adapted) GN=TMK PE=3
SV=1
Length = 240

Score = 34.7 bits (78), Expect = 0.31
Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 7/95 (7%)
Frame = +3

Query: 165 GIGGAGKSTACMLITESMRKAFSGRVCHVEFKPDTSTLKLQCTVLRELIRDNEVFLDRHM 344
GI G GKST M + +++ VC PDT+T L VL ++ + L +
Sbjct: 10 GINGVGKSTQAMRLKKALECMDYNAVCIRFPNPDTTTGGLILQVLNKMTEMSSEQLHKLF 69

Query: 345 TNEHKVG*CEMSLFLVLN-------QEWASLVWAK 428
T H E++ L LN W+ L +A+
Sbjct: 70 TKHHSEFSAEIAALLKLNFIVIVDHYIWSGLAYAQ 104


>sp|P0C8G2|KTHY_ASFWA Thymidylate kinase OS=African swine fever
virus (isolate Warthog/Namibia/Wart80/1980) GN=TMK PE=3
SV=1
Length = 239

Score = 33.1 bits (74), Expect = 0.91
Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 7/100 (7%)
Frame = +3

Query: 150 VLGMFGIGGAGKSTACMLITESMRKAFSGRVCHVEFKPDTSTLKLQCTVLRELIRDNEVF 329
++ + GI G GKST M + +++ VC PDT+T L VL ++I +
Sbjct: 5 LIAIEGINGVGKSTQAMRLKKALECMDYNAVCIRFPNPDTTTGDLILQVLNKMIEMSSEQ 64

Query: 330 LDRHMTNEHKVG*CEMSLFLVLN-------QEWASLVWAK 428
L + T E++ L LN W+ L +A+
Sbjct: 65 LHKLFTKHCSEFVAEIAALLKLNFIVIVDRYIWSGLAYAQ 104


>sp|P25941|AFSR_STRCO Regulatory protein afsR OS=Streptomyces
coelicolor GN=afsR PE=3 SV=2
Length = 993

Score = 32.3 bits (72), Expect = 1.5
Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 3/78 (3%)
Frame = +3

Query: 36 PSDVRSSVLHVQGRERICKELQAKFNAALPSQRIASTKVLG---MFGIGGAGKSTACMLI 206
P+ + ++V GR +EL +AA S AS +V+ + GIGG GK+T + +
Sbjct: 286 PAQLPATVSDFTGRAAFVRELSDVLSAA--SGESASGRVMAVSALAGIGGVGKTTLAVHV 343

Query: 207 TESMRKAFSGRVCHVEFK 260
R AF +V+ +
Sbjct: 344 AHRARAAFPDGQLYVDLQ 361


>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250
OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1
Length = 843

Score = 31.2 bits (69), Expect = 3.4
Identities = 26/86 (30%), Positives = 37/86 (43%), Gaps = 6/86 (6%)
Frame = +3

Query: 81 RICKE---LQAKFNAALPSQRIASTKVLGMFGIGGAGKSTACMLITESMRKAFSGR--VC 245
R+C++ L S R ++LG+FG+GG GK+T LI + V
Sbjct: 152 RLCQQTVGLDTTLEKTWESLRKDENRMLGIFGMGGVGKTTLLTLINNKFVEVSDDYDVVI 211

Query: 246 HVEFKPDTSTLKLQCTVLREL-IRDN 320
VE D K+Q + L I DN
Sbjct: 212 WVESSKDADVGKIQDAIGERLHICDN 237


>sp|P18770|CYAB_BORPE Cyclolysin secretion/processing ATP-binding
protein cyaB OS=Bordetella pertussis GN=cyaB PE=3 SV=2
Length = 712

Score = 31.2 bits (69), Expect = 3.4
Identities = 31/89 (34%), Positives = 45/89 (50%), Gaps = 10/89 (11%)
Frame = +3

Query: 126 SQRIASTKVLGMFGIGGAGKSTACMLITESMRKAFSGRVC---HVEFKPDTSTLKLQ--- 287
S RIA +V+G+ G G+GKST LI + M A GRV H D+++L+ Q
Sbjct: 492 SLRIAPGEVVGVVGRSGSGKSTLTRLI-QRMFVADRGRVLIDGHDIGIVDSASLRRQLGV 550

Query: 288 ----CTVLRELIRDNEVFLDRHMTNEHKV 362
T+ +RDN + L R + H+V
Sbjct: 551 VLQESTLFNRSVRDN-IALTRPGASMHEV 578


>sp|P11641|Y32K_MCMV Uncharacterized 32.7 kDa protein OS=Maize
chlorotic mottle virus PE=4 SV=2
Length = 290

Score = 30.8 bits (68), Expect = 4.5
Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 4/46 (8%)
Frame = -3

Query: 221 PHGFRNQHTC----CALACSSNTKHAKHFSACNSLGWQSSIELCLQ 96
P+G+++ H C C+ C+S +H++ ++ W SS C Q
Sbjct: 229 PNGWQHNHRCGIQLCSTLCASLGRHSQQTPLADTFPWHSSPITCYQ 274


>sp|Q8BUR4|DOCK1_MOUSE Dedicator of cytokinesis protein 1 OS=Mus
musculus GN=Dock1 PE=1 SV=3
Length = 1865

Score = 30.8 bits (68), Expect = 4.5
Identities = 17/52 (32%), Positives = 23/52 (44%)
Frame = -3

Query: 203 QHTCCALACSSNTKHAKHFSACNSLGWQSSIELCLQLLANTFSALHMQDTGP 48
QH C + T K+ L Q +E C QLL+N L+ +D GP
Sbjct: 852 QHDCREILLPMMTDQLKYH-----LERQEELEACCQLLSNILEVLYRKDVGP 898


>sp|Q9CP98|RBSA1_PASMU Ribose import ATP-binding protein rbsA 1
OS=Pasteurella multocida GN=rbsA1 PE=3 SV=1
Length = 498

Score = 30.4 bits (67), Expect = 5.9
Identities = 16/52 (30%), Positives = 30/52 (57%)
Frame = +3

Query: 54 SVLHVQGRERICKELQAKFNAALPSQRIASTKVLGMFGIGGAGKSTACMLIT 209
++LH+QG ++ ++A NA L + + + + + G GAGKST ++T
Sbjct: 5 TLLHIQGIDKSFPGVKALSNACLS---VYAGRAMALMGENGAGKSTLMKVLT 53


>sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania
tarentolae GN=PGPA PE=3 SV=2
Length = 1548

Score = 30.4 bits (67), Expect = 5.9
Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 7/74 (9%)
Frame = +3

Query: 51 SSVLH-VQGRERICKELQAKFNAALP------SQRIASTKVLGMFGIGGAGKSTACMLIT 209
SS LH VQ + + +Q ++ LP S +IA + +G+ G G+GKST +L+T
Sbjct: 1275 SSALHPVQAGSLVLEGVQMRYREGLPLVLRGVSFQIAPREKVGIVGRTGSGKST--LLLT 1332

Query: 210 ESMRKAFSGRVCHV 251
G V HV
Sbjct: 1333 FMRMVEVCGGVIHV 1346


>sp|Q65WJ1|ARAG_MANSM Arabinose import ATP-binding protein araG
OS=Mannheimia succiniciproducens (strain MBEL55E)
GN=araG PE=3 SV=1
Length = 502

Score = 30.4 bits (67), Expect = 5.9
Identities = 19/55 (34%), Positives = 30/55 (54%)
Frame = +3

Query: 42 DVRSSVLHVQGRERICKELQAKFNAALPSQRIASTKVLGMFGIGGAGKSTACMLI 206
DVR + H+ G ++LQ F S + + +VLG+FG+ GAG+S +I
Sbjct: 256 DVRLKIAHLSG-----EKLQGDF-----SLTVRAGEVLGLFGLVGAGRSELLKVI 300


tr_hit_id A9TDN3
Definition tr|A9TDN3|A9TDN3_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 100
Score (bit) 63.5
E-value 7.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917267|Adiantum capillus-veneris mRNA, clone:
YMU001_000098_E07.
(550 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TDN3|A9TDN3_PHYPA Predicted protein OS=Physcomitrella paten... 64 7e-09
tr|A9RG57|A9RG57_PHYPA Predicted protein OS=Physcomitrella paten... 51 3e-05
tr|A9TC59|A9TC59_PHYPA Predicted protein OS=Physcomitrella paten... 47 7e-04
tr|B3V825|B3V825_TOBAC NBS-coding resistance gene analog (Fragme... 41 0.036
tr|B8JAW6|B8JAW6_9DELT Curli production assembly/transport compo... 38 0.40
tr|A7PQ77|A7PQ77_VITVI Chromosome chr18 scaffold_24, whole genom... 38 0.40
tr|A5BKE7|A5BKE7_VITVI Putative uncharacterized protein OS=Vitis... 38 0.40
tr|Q2IMY7|Q2IMY7_ANADE Curli production assembly/transport compo... 37 0.52
tr|Q0SII3|Q0SII3_RHOSR ABC ribose transporter, ATP-binding compo... 37 0.52
tr|B4UB13|B4UB13_ANASK Curli production assembly/transport compo... 37 0.52
tr|Q5DMW2|Q5DMW2_CUCME MRGH9 OS=Cucumis melo GN=MRGH9 PE=4 SV=1 37 0.52
tr|Q2QZS8|Q2QZS8_ORYSJ NB-ARC domain containing protein OS=Oryza... 37 0.52
tr|A7QN76|A7QN76_VITVI Chromosome undetermined scaffold_131, who... 37 0.52
tr|A7PQA5|A7PQA5_VITVI Chromosome chr18 scaffold_24, whole genom... 37 0.68
tr|A1W696|A1W696_ACISJ Helicase domain protein OS=Acidovorax sp.... 37 0.89
tr|A7PQA2|A7PQA2_VITVI Chromosome chr18 scaffold_24, whole genom... 37 0.89
tr|Q6K4U3|Q6K4U3_ORYSJ Os02g0301800 protein OS=Oryza sativa subs... 36 1.2
tr|B8AFX7|B8AFX7_ORYSI Putative uncharacterized protein OS=Oryza... 36 1.2
tr|A9T1I0|A9T1I0_PHYPA Predicted protein OS=Physcomitrella paten... 36 1.2
tr|A9RWI1|A9RWI1_PHYPA Predicted protein (Fragment) OS=Physcomit... 36 1.5
tr|Q8LKP5|Q8LKP5_AEGTA Putative NBS-LRR resistance protein OS=Ae... 35 2.0
tr|A9CR80|A9CR80_TOBAC N-like protein OS=Nicotiana tabacum GN=NL... 35 2.0
tr|Q4FAB7|Q4FAB7_TOXGO ATP-binding cassette sub-family E member ... 35 2.0
tr|A5N7P8|A5N7P8_CLOK5 Predicted ABC transporter, ATPase compone... 35 2.6
tr|Q9ZS32|Q9ZS32_SOLTU NL25 OS=Solanum tuberosum GN=nl25 PE=2 SV=1 35 2.6
tr|A9THG7|A9THG7_PHYPA Predicted protein (Fragment) OS=Physcomit... 35 2.6
tr|A9SQC0|A9SQC0_PHYPA Predicted protein OS=Physcomitrella paten... 35 2.6
tr|A7QPI8|A7QPI8_VITVI Chromosome chr18 scaffold_137, whole geno... 35 2.6
tr|A7Q7V0|A7Q7V0_VITVI Chromosome chr18 scaffold_61, whole genom... 35 2.6
tr|A9JLM6|A9JLM6_ASFPP Thymidylate kinase OS=African swine fever... 35 3.4

>tr|A9TDN3|A9TDN3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_169462 PE=4 SV=1
Length = 1173

Score = 63.5 bits (153), Expect = 7e-09
Identities = 35/100 (35%), Positives = 54/100 (54%)
Frame = +3

Query: 9 ILKSVMETMPSDVRSSVLHVQGRERICKELQAKFNAALPSQRIASTKVLGMFGIGGAGKS 188
++ + + +P DV VQGR RIC+ + KF S R +V+G++G GG GK+
Sbjct: 254 VVSYLCDLVPPDVWWDDSDVQGRLRICRRILGKFEKTCESLR-NGVRVVGLYGTGGIGKT 312

Query: 189 TACMLITESMRKAFSGRVCHVEFKPDTSTLKLQCTVLREL 308
T C ++ + K F G+VCH E TL+L V++ L
Sbjct: 313 TFCKVLCNELDKKFHGKVCHAEL--GNPTLELLKVVIKTL 350


>tr|A9RG57|A9RG57_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_65683 PE=4 SV=1
Length = 983

Score = 51.2 bits (121), Expect = 3e-05
Identities = 34/102 (33%), Positives = 47/102 (46%)
Frame = +3

Query: 9 ILKSVMETMPSDVRSSVLHVQGRERICKELQAKFNAALPSQRIASTKVLGMFGIGGAGKS 188
I+K + P V + +G ERICK L F A + LG++G+GG GK+
Sbjct: 212 IVKKIWYLCPPHVPYDLDEKEGWERICKVLSGLFVAD------EGVEKLGIYGMGGLGKT 265

Query: 189 TACMLITESMRKAFSGRVCHVEFKPDTSTLKLQCTVLRELIR 314
T C + F GRV H+E L LQ +L+ L R
Sbjct: 266 TICKGMCNYFHGHFFGRVFHLELVSGRKQLDLQKQMLKTLFR 307


>tr|A9TC59|A9TC59_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_169270 PE=4 SV=1
Length = 1083

Score = 47.0 bits (110), Expect = 7e-04
Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
Frame = +3

Query: 75 RERICKE---LQAKFNAALPSQRIASTKVLGMFGIGGAGKSTACMLITESMRKAFSGRVC 245
R R C+ + AK PS+R +V+G++G GG GK+T C + + + F G+VC
Sbjct: 254 RWRSCQNSMRILAKVEKTCPSRRDGG-RVVGLYGAGGIGKTTFCKELLDELETKFHGKVC 312

Query: 246 HVEFKPDTSTLKLQCTV 296
H+E T LQ +
Sbjct: 313 HMEIGSHTHEKFLQLLI 329


>tr|B3V825|B3V825_TOBAC NBS-coding resistance gene analog (Fragment)
OS=Nicotiana tabacum GN=NBS141-r PE=4 SV=1
Length = 269

Score = 41.2 bits (95), Expect = 0.036
Identities = 27/102 (26%), Positives = 51/102 (50%)
Frame = +3

Query: 51 SSVLHVQGRERICKELQAKFNAALPSQRIASTKVLGMFGIGGAGKSTACMLITESMRKAF 230
SS+ + G + ++L++ + + RI +LG++G+GG GK+T I +++ F
Sbjct: 12 SSLRDIVGIDTHLEKLKSLLKVGINNVRI----ILGIWGMGGVGKTTIARAIFDNLSHQF 67

Query: 231 SGRVCHVEFKPDTSTLKLQCTVLRELIRDNEVFLDRHMTNEH 356
+ K + LQ T+L EL+R D ++ N+H
Sbjct: 68 EASCFLADIKENEKLHSLQNTLLSELLRRK----DDYVNNKH 105


>tr|B8JAW6|B8JAW6_9DELT Curli production assembly/transport
component CsgG OS=Anaeromyxobacter dehalogenans 2CP-1
GN=A2cp1_0420 PE=3 SV=1
Length = 321

Score = 37.7 bits (86), Expect = 0.40
Identities = 21/69 (30%), Positives = 32/69 (46%)
Frame = +3

Query: 57 VLHVQGRERICKELQAKFNAALPSQRIASTKVLGMFGIGGAGKSTACMLITESMRKAFSG 236
VL V K Q F ALP +R+ + KVL +FG G + C + + ++ KA
Sbjct: 253 VLAVMEAGNTVKSRQTGFEVALPPKRVGTIKVLSLFGDGETSEGAVCEVTSGTIEKAVLP 312

Query: 237 RVCHVEFKP 263
++ E P
Sbjct: 313 KLFVAEATP 321


>tr|A7PQ77|A7PQ77_VITVI Chromosome chr18 scaffold_24, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021951001
PE=4 SV=1
Length = 879

Score = 37.7 bits (86), Expect = 0.40
Identities = 27/116 (23%), Positives = 56/116 (48%), Gaps = 6/116 (5%)
Frame = +3

Query: 3 ERILKSVMETMPSDVRSSVLHVQ----GRERICKELQAKFNAALPSQRIASTKVLGMFGI 170
E+ +V++ + D+ + H Q G+ + + +L ++ V+G+ GI
Sbjct: 165 EQYETNVLKEITDDIIRRLNHDQPLNVGKNIVGMSFHLEKLKSLMKKKFNEVCVVGICGI 224

Query: 171 GGAGKSTACMLITESMRKAFSGR--VCHVEFKPDTSTLKLQCTVLRELIRDNEVFL 332
GG GK+T M I + + G + V+ + + TL+LQ +L++++R + L
Sbjct: 225 GGIGKTTVAMAIYNELSNQYDGSSFLRKVKERSERDTLQLQHELLQDILRGKSLKL 280


>tr|A5BKE7|A5BKE7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_003124 PE=4 SV=1
Length = 1039

Score = 37.7 bits (86), Expect = 0.40
Identities = 27/116 (23%), Positives = 56/116 (48%), Gaps = 6/116 (5%)
Frame = +3

Query: 3 ERILKSVMETMPSDVRSSVLHVQ----GRERICKELQAKFNAALPSQRIASTKVLGMFGI 170
E+ +V++ + D+ + H Q G+ + + +L ++ V+G+ GI
Sbjct: 165 EQYETNVLKEITGDIIRRLNHDQPLNVGKNIVGMSFHLEKLKSLMKKKFNEVCVVGICGI 224

Query: 171 GGAGKSTACMLITESMRKAFSGR--VCHVEFKPDTSTLKLQCTVLRELIRDNEVFL 332
GG GK+T M I + + G + V+ + + TL+LQ +L++++R + L
Sbjct: 225 GGIGKTTVAMAIYNELSNQYDGSSFLRKVKERSERDTLQLQHELLQDILRGKSLKL 280


>tr|Q2IMY7|Q2IMY7_ANADE Curli production assembly/transport
component CsgG OS=Anaeromyxobacter dehalogenans (strain
2CP-C) GN=Adeh_0391 PE=3 SV=1
Length = 320

Score = 37.4 bits (85), Expect = 0.52
Identities = 19/58 (32%), Positives = 29/58 (50%)
Frame = +3

Query: 90 KELQAKFNAALPSQRIASTKVLGMFGIGGAGKSTACMLITESMRKAFSGRVCHVEFKP 263
K Q F ALP +R+ + KVL +FG G + C L + ++ KA ++ E P
Sbjct: 263 KSRQTGFEVALPPKRVGTLKVLSLFGDGETSEGAVCELTSGTIEKASLPKLFVAEATP 320


>tr|Q0SII3|Q0SII3_RHOSR ABC ribose transporter, ATP-binding
component OS=Rhodococcus sp. (strain RHA1)
GN=RHA1_ro00820 PE=3 SV=1
Length = 511

Score = 37.4 bits (85), Expect = 0.52
Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 4/84 (4%)
Frame = +3

Query: 126 SQRIASTKVLGMFGIGGAGKSTACMLITESMRKAFSGRVC----HVEFKPDTSTLKLQCT 293
S + + +V+G+ GI GAG+S C L+ KA +GRV HV+ ST
Sbjct: 278 SLEVRAGEVVGLAGIVGAGRSELCRLVA-GFDKAAAGRVVVDERHVDLGTPRSTAAAGIV 336

Query: 294 VLRELIRDNEVFLDRHMTNEHKVG 365
+L E ++ +FLD + + +G
Sbjct: 337 MLPESRKEQGLFLDMSIADNVCLG 360


>tr|B4UB13|B4UB13_ANASK Curli production assembly/transport
component CsgG OS=Anaeromyxobacter sp. (strain K)
GN=AnaeK_0419 PE=3 SV=1
Length = 321

Score = 37.4 bits (85), Expect = 0.52
Identities = 21/69 (30%), Positives = 32/69 (46%)
Frame = +3

Query: 57 VLHVQGRERICKELQAKFNAALPSQRIASTKVLGMFGIGGAGKSTACMLITESMRKAFSG 236
VL V K Q F ALP +R+ + KVL +FG G + C + + ++ KA
Sbjct: 253 VLAVMEAGNTVKSRQTGFEVALPPKRVGTIKVLSLFGDGETSEGAVCEVTSGAIEKAALP 312

Query: 237 RVCHVEFKP 263
++ E P
Sbjct: 313 KLFVAEATP 321