BP917300
Clone id YMU001_000099_A06
Library
Length 478
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000099_A06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CATCTTTGAAAGAAGAACCAATTATTGGGCAGACACATAGTGTGAGAGTTGTGCATGCTA
GCGGTCGTCGACCAGATACGATTGCATGAAATGATGGCACATGATTGGGCTATATATGTT
CCTGGTGGGCTTTCCTTCCAAGCAAGGTACAGCAAATATATGTAATTATCTAGGGAGTTT
TCACAATGTTCCCAGTGAATTTACTTTAATGAGTGGATCCAATGCAATATGCACTCTCTC
TCCTCGATAAGCTCTTATGCGAGGTCAATTATGATGTAAGGGCAAGTTAAGAGGCCGGTG
CGAGTATTTGCGCCCTATCCATCGGGCTGTCTGGGGCGATCAGATGATTGGCACGTGTCT
TATGCCTTCAGCCTTTCATCAGGATGCGTATTTACGCACAATGTACCAGGCTGTTGGAGA
TGGTGATCAATGATTGGCATGTATCCTAGCCTTATTATTACGATATCTGCAGTTGAAG
■■Homology search results ■■ -
sp_hit_id Q46909
Definition sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein ygcS OS=Escherichia coli (strain K12)
Align length 39
Score (bit) 29.6
E-value 7.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917300|Adiantum capillus-veneris mRNA, clone:
YMU001_000099_A06.
(478 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein... 30 7.4
sp|P94459|PPSD_BACSU Plipastatin synthetase subunit D OS=Bacillu... 30 7.4
sp|Q0HT72|LPXD_SHESR UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 29 9.4
sp|Q0HGW5|LPXD_SHESM UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 29 9.4
sp|Q2JBP8|KATG_FRASC Catalase-peroxidase OS=Frankia sp. (strain ... 29 9.6

>sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein
ygcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2
Length = 445

Score = 29.6 bits (65), Expect = 7.4
Identities = 13/39 (33%), Positives = 18/39 (46%)
Frame = +1

Query: 349 WHVSYAFSLSSGCVFTHNVPGCWRW*SMIGMYPSLIITI 465
W V Y + +G F P WRW P+L+IT+
Sbjct: 152 WTVGYVLASIAGHHFISENPEAWRWLLASAALPALLITL 190


>sp|P94459|PPSD_BACSU Plipastatin synthetase subunit D OS=Bacillus
subtilis GN=ppsD PE=1 SV=1
Length = 3603

Score = 29.6 bits (65), Expect = 7.4
Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
Frame = -2

Query: 333 QTARWIGRKYSHRP-LNLPLHHN*PRIRAYRGERVHIALDP 214
Q A W+ + P L+LP H P +R++ G++V L+P
Sbjct: 2264 QEAYWLKQLEGELPVLDLPADHARPPVRSFAGDKVSFTLEP 2304


>sp|Q0HT72|LPXD_SHESR UDP-3-O-[3-hydroxymyristoyl] glucosamine
N-acyltransferase OS=Shewanella sp. (strain MR-7)
GN=lpxD PE=3 SV=1
Length = 341

Score = 29.3 bits (64), Expect = 9.4
Identities = 12/27 (44%), Positives = 14/27 (51%)
Frame = -3

Query: 122 GTYIAQSCAIISCNRIWSTTASMHNSH 42
GT I Q C I S R+W+ HN H
Sbjct: 139 GTVIGQDCIIGSNTRLWANVTLYHNVH 165


>sp|Q0HGW5|LPXD_SHESM UDP-3-O-[3-hydroxymyristoyl] glucosamine
N-acyltransferase OS=Shewanella sp. (strain MR-4)
GN=lpxD PE=3 SV=1
Length = 341

Score = 29.3 bits (64), Expect = 9.4
Identities = 12/27 (44%), Positives = 14/27 (51%)
Frame = -3

Query: 122 GTYIAQSCAIISCNRIWSTTASMHNSH 42
GT I Q C I S R+W+ HN H
Sbjct: 139 GTVIGQDCIIGSNTRLWANVTLYHNVH 165


>sp|Q2JBP8|KATG_FRASC Catalase-peroxidase OS=Frankia sp. (strain
CcI3) GN=katG PE=3 SV=1
Length = 744

Score = 29.3 bits (64), Expect = 9.6
Identities = 12/36 (33%), Positives = 21/36 (58%)
Frame = +2

Query: 164 NYLGSFHNVPSEFTLMSGSNAICTLSPR*ALMRGQL 271
NYLG H +P+E+ L+ +N + +P ++ G L
Sbjct: 599 NYLGKGHRLPAEYLLLDRANQLTLSAPELTVLVGGL 634


tr_hit_id Q4FWQ4
Definition tr|Q4FWQ4|Q4FWQ4_LEIMA Putative uncharacterized protein OS=Leishmania major strain Friedlin
Align length 89
Score (bit) 36.6
E-value 0.64
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917300|Adiantum capillus-veneris mRNA, clone:
YMU001_000099_A06.
(478 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4FWQ4|Q4FWQ4_LEIMA Putative uncharacterized protein OS=Leish... 37 0.64
tr|A4HYF4|A4HYF4_LEIIN Putative uncharacterized protein OS=Leish... 34 3.2
tr|Q6WZA0|Q6WZA0_STRVI Nonribosomal peptide synthetase OS=Strept... 33 9.2

>tr|Q4FWQ4|Q4FWQ4_LEIMA Putative uncharacterized protein
OS=Leishmania major strain Friedlin GN=LMJ_1145 PE=4
SV=1
Length = 440

Score = 36.6 bits (83), Expect = 0.64
Identities = 27/89 (30%), Positives = 40/89 (44%)
Frame = -2

Query: 327 ARWIGRKYSHRPLNLPLHHN*PRIRAYRGERVHIALDPLIKVNSLGTL*KLPR*LHIFAV 148
A W+ RKY+ R + + +++ +A R R H L+ +N LG P L +
Sbjct: 166 AEWVARKYAQRNVQVLVNNAGGMRKALRFSRFHPNLELHTAMNFLG-----PLLLTELLL 220

Query: 147 PCLEGKPTRNIYSPIMCHHFMQSYLVDDR 61
P LE R +Y H F QS L+ R
Sbjct: 221 PVLERNGGRVVYVSSEAHRFAQSLLLPGR 249


>tr|A4HYF4|A4HYF4_LEIIN Putative uncharacterized protein
OS=Leishmania infantum GN=LinJ19.1170 PE=4 SV=1
Length = 440

Score = 34.3 bits (77), Expect = 3.2
Identities = 26/89 (29%), Positives = 40/89 (44%)
Frame = -2

Query: 327 ARWIGRKYSHRPLNLPLHHN*PRIRAYRGERVHIALDPLIKVNSLGTL*KLPR*LHIFAV 148
A W+ RKY+ R + + +++ +A R+H L+ +N LG P L +
Sbjct: 166 AEWVARKYAQRNVQVLVNNAGGMRKALGFSRLHPNLELHTAMNFLG-----PFLLTELLL 220

Query: 147 PCLEGKPTRNIYSPIMCHHFMQSYLVDDR 61
P LE R +Y H F QS L+ R
Sbjct: 221 PVLERNGGRVVYVSSEAHRFAQSLLLPGR 249


>tr|Q6WZA0|Q6WZA0_STRVI Nonribosomal peptide synthetase
OS=Streptomyces vinaceus GN=vioM PE=4 SV=1
Length = 457

Score = 32.7 bits (73), Expect = 9.2
Identities = 15/39 (38%), Positives = 19/39 (48%)
Frame = -2

Query: 336 PQTARWIGRKYSHRPLNLPLHHN*PRIRAYRGERVHIAL 220
P ARW R PL LP P +R RG+RV + +
Sbjct: 198 PALARWRARLEGAAPLRLPTDRARPEVRTARGDRVEVVV 236