BP917346
Clone id YMU001_000099_F10
Library
Length 503
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000099_F10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATTCCTCTAACTGTTTTAACTTAATGTGCAAGTTTTCATTTTCTTCTCTGATTGATTTGG
AAACAATGCTTTCCATTTCACTGTCAGGAGCTGGTCCTTGTTGTTGTTCACTTTGCAAGT
CTGAAATTTGTCTTTGTAGTTGATCTTCTGCTCTAAGCGCACTTTCAGCAATCATTAAAC
GCTGTTTTCTTTCCAACTCTAGCTTGTGTCCTCCAATGGTGTTAATAGATGCCGGTACTT
TCCTTTGTGGTCTGTCTTCGCTATTTTCCCTTAATACCAGCCAGTCGTTCTGATGAGGGG
CAGGTGGCAACTGATCTGCCGCGCCTATGGCATGGTATATTACTCTGGTTAGGACTTCTC
CTCCTGCAATGCAATTGGGTCTGTCCTGCCTTAGCTTTGTCATTTCTTCAAACATATATG
ACGCGTGATCTATATAGAACTCACGGGTCATTCCCATAGCCCATGTCAGTGTGGTTGAGA
TGCTCCCGTGCGGTGTAGTGTAT
■■Homology search results ■■ -
sp_hit_id P35241
Definition sp|P35241|RADI_HUMAN Radixin OS=Homo sapiens
Align length 72
Score (bit) 32.7
E-value 0.98
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917346|Adiantum capillus-veneris mRNA, clone:
YMU001_000099_F10.
(503 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P35241|RADI_HUMAN Radixin OS=Homo sapiens GN=RDX PE=1 SV=1 33 0.98
sp|Q501L3|K1826_RAT Coiled-coil domain-containing protein KIAA18... 33 0.98
sp|Q91YU3|K1826_MOUSE Coiled-coil domain-containing protein KIAA... 33 0.98
sp|Q0P5D1|CC153_BOVIN Coiled-coil domain-containing protein 153 ... 33 0.98
sp|Q8C1D8|IWS1_MOUSE Protein IWS1 homolog OS=Mus musculus GN=Iws... 32 1.3
sp|Q54I30|Y8231_DICDI Putative uncharacterized protein DDB_G0289... 32 1.7
sp|P26038|MOES_HUMAN Moesin OS=Homo sapiens GN=MSN PE=1 SV=3 32 1.7
sp|P48725|PCNT_MOUSE Pericentrin OS=Mus musculus GN=Pcnt PE=2 SV=1 32 2.2
sp|Q60LV4|MYO3_CAEBR Myosin-3 OS=Caenorhabditis briggsae GN=myo-... 32 2.2
sp|Q3TDD9|KLRAQ_MOUSE KLRAQ motif-containing protein 1 OS=Mus mu... 32 2.2
sp|Q6ZMI0|KLRAQ_HUMAN KLRAQ motif-containing protein 1 OS=Homo s... 32 2.2
sp|O23372|ATXR3_ARATH Probable histone-lysine N-methyltransferas... 32 2.2
sp|Q54JH8|Y7752_DICDI Putative uncharacterized protein DDB_G0288... 31 2.9
sp|O35763|MOES_RAT Moesin OS=Rattus norvegicus GN=Msn PE=1 SV=3 31 2.9
sp|P26042|MOES_PIG Moesin OS=Sus scrofa GN=MSN PE=2 SV=3 31 2.9
sp|P26041|MOES_MOUSE Moesin OS=Mus musculus GN=Msn PE=1 SV=3 31 2.9
sp|Q2HJ49|MOES_BOVIN Moesin OS=Bos taurus GN=MSN PE=2 SV=3 31 2.9
sp|Q3SWT4|IWS1_RAT Protein IWS1 homolog OS=Rattus norvegicus GN=... 31 2.9
sp|P56524|HDAC4_HUMAN Histone deacetylase 4 OS=Homo sapiens GN=H... 31 2.9
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosa... 31 2.9
sp|Q5R7H1|CACO2_PONAB Calcium-binding and coiled-coil domain-con... 31 2.9
sp|P27206|SRFAA_BACSU Surfactin synthetase subunit 1 OS=Bacillus... 31 3.7
sp|Q8R322|GLE1_MOUSE Nucleoporin GLE1 OS=Mus musculus GN=Gle1 PE... 31 3.7
sp|O60610|DIAP1_HUMAN Protein diaphanous homolog 1 OS=Homo sapie... 31 3.7
sp|A2AL36|CP110_MOUSE Centriolin OS=Mus musculus GN=Cep110 PE=1 ... 31 3.7
sp|Q13137|CACO2_HUMAN Calcium-binding and coiled-coil domain-con... 31 3.7
sp|Q10411|SPO15_SCHPO Sporulation-specific protein 15 OS=Schizos... 30 4.9
sp|P02565|MYH3_CHICK Myosin-3 OS=Gallus gallus GN=MYH3 PE=2 SV=3 30 4.9
sp|B0CC88|ISPE_ACAM1 4-diphosphocytidyl-2-C-methyl-D-erythritol ... 30 4.9
sp|Q9LD55|EIF3A_ARATH Eukaryotic translation initiation factor 3... 30 4.9

>sp|P35241|RADI_HUMAN Radixin OS=Homo sapiens GN=RDX PE=1 SV=1
Length = 583

Score = 32.7 bits (73), Expect = 0.98
Identities = 18/72 (25%), Positives = 35/72 (48%)
Frame = -2

Query: 217 IGGHKLELERKQRLMIAESALRAEDQLQRQISDLQSEQQQGPAPDSEMESIVSKSIREEN 38
+G H+L + R++ I ++A+ + ++ L+ Q + E+ + I E
Sbjct: 285 MGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREK 344

Query: 37 ENLHIKLKQLEE 2
E L +LKQ+EE
Sbjct: 345 EELMERLKQIEE 356


>sp|Q501L3|K1826_RAT Coiled-coil domain-containing protein KIAA1826
homolog OS=Rattus norvegicus PE=2 SV=1
Length = 345

Score = 32.7 bits (73), Expect = 0.98
Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 6/79 (7%)
Frame = -2

Query: 316 DQLPPAPHQNDWLVLRENSEDRPQRKVPASINTIGGHKLELERK------QRLMIAESAL 155
++LP PH +++ L ++ RP P + I KLELE++ +RL + + L
Sbjct: 175 NELPDFPHIDEFFTLN-STPSRPTYDEPHLLMNIEKQKLELEKRRLDIEAERLQVEKERL 233

Query: 154 RAEDQLQRQISDLQSEQQQ 98
+ E + R + DL+ E+ Q
Sbjct: 234 QIEKERLRHL-DLEHERLQ 251


>sp|Q91YU3|K1826_MOUSE Coiled-coil domain-containing protein
KIAA1826 homolog OS=Mus musculus PE=2 SV=1
Length = 345

Score = 32.7 bits (73), Expect = 0.98
Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 6/79 (7%)
Frame = -2

Query: 316 DQLPPAPHQNDWLVLRENSEDRPQRKVPASINTIGGHKLELERK------QRLMIAESAL 155
++LP PH +++ L ++ RP P + I KLELE++ +RL + + L
Sbjct: 175 NELPDFPHIDEFFTLN-STPSRPTYDEPHLLMNIEKQKLELEKRRLDIEAERLQVEKERL 233

Query: 154 RAEDQLQRQISDLQSEQQQ 98
+ E + R + DL+ E+ Q
Sbjct: 234 QIEKERLRHL-DLEHERLQ 251


>sp|Q0P5D1|CC153_BOVIN Coiled-coil domain-containing protein 153
OS=Bos taurus GN=CCDC153 PE=2 SV=1
Length = 204

Score = 32.7 bits (73), Expect = 0.98
Identities = 17/56 (30%), Positives = 32/56 (57%)
Frame = -2

Query: 169 AESALRAEDQLQRQISDLQSEQQQGPAPDSEMESIVSKSIREENENLHIKLKQLEE 2
A A +EDQL+++I DL++E + + + + +S+ R E + + +QLEE
Sbjct: 52 ARRAKASEDQLKQRIKDLEAELEGARSEGKAIYAEMSRQCRSLQEAMQSRSRQLEE 107


>sp|Q8C1D8|IWS1_MOUSE Protein IWS1 homolog OS=Mus musculus GN=Iws1
PE=1 SV=1
Length = 766

Score = 32.3 bits (72), Expect = 1.3
Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 2/65 (3%)
Frame = -2

Query: 217 IGGHKLELERKQRLMIAESALRAEDQLQRQISDLQSEQQQGP-APDSEMESIVSKSIRE- 44
+ GH + E+++ A S AED LQ Q+S+ SE P A DSE E I +
Sbjct: 126 LNGHASDSEKEEVSKHAASDSEAEDTLQPQVSESDSEDPPRPQASDSENEEPPKPRISDS 185

Query: 43 ENENL 29
E+E L
Sbjct: 186 ESEEL 190



Score = 29.6 bits (65), Expect = 8.3
Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 1/80 (1%)
Frame = -2

Query: 307 PPAPHQNDWLVLRENSEDRPQRKVPASINTIGGHKLELERKQRLMIAESALRAEDQLQRQ 128
PP P +D SE+ P+ +V S E E R ++S +E+ + +
Sbjct: 203 PPRPQASD-----SESEELPKPRVSDS---------ESEDPPRPQASDS--ESEELPKPR 246

Query: 127 ISDLQSEQ-QQGPAPDSEME 71
+SD +SE Q+GPA DSE E
Sbjct: 247 VSDSESEDPQKGPASDSEAE 266


>sp|Q54I30|Y8231_DICDI Putative uncharacterized protein DDB_G0289041
OS=Dictyostelium discoideum GN=DDB_G0289041 PE=4 SV=1
Length = 849

Score = 32.0 bits (71), Expect = 1.7
Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 5/75 (6%)
Frame = -2

Query: 241 KVPASI-NTIGGHKLELERKQRLMIAESALRAEDQLQRQISDLQSE----QQQGPAPDSE 77
++P +I N I G++ L R+ +L++ + L DQ Q + LQ + QQQ P +
Sbjct: 282 EIPIAIKNLINGYRDHL-RENKLLLTQPELEIIDQQQEEHQQLQQQLQQQQQQLQQPQQK 340

Query: 76 MESIVSKSIREENEN 32
E + KSI E EN
Sbjct: 341 SE-VQQKSIVENEEN 354


>sp|P26038|MOES_HUMAN Moesin OS=Homo sapiens GN=MSN PE=1 SV=3
Length = 577

Score = 32.0 bits (71), Expect = 1.7
Identities = 17/72 (23%), Positives = 34/72 (47%)
Frame = -2

Query: 217 IGGHKLELERKQRLMIAESALRAEDQLQRQISDLQSEQQQGPAPDSEMESIVSKSIREEN 38
+G H+L + R++ I ++A+ + ++ ++ + EM + I E
Sbjct: 285 MGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREK 344

Query: 37 ENLHIKLKQLEE 2
E L +LKQ+EE
Sbjct: 345 EELMERLKQIEE 356


>sp|P48725|PCNT_MOUSE Pericentrin OS=Mus musculus GN=Pcnt PE=2 SV=1
Length = 1920

Score = 31.6 bits (70), Expect = 2.2
Identities = 14/54 (25%), Positives = 28/54 (51%)
Frame = -2

Query: 163 SALRAEDQLQRQISDLQSEQQQGPAPDSEMESIVSKSIREENENLHIKLKQLEE 2
SA + ++ + ++DLQ +QQ P P S+ +++R N+H +L +
Sbjct: 86 SAAQEQEDCELDVTDLQGQQQTQPPPPQTAHSLELEALRLSLNNMHTAQLELTQ 139


>sp|Q60LV4|MYO3_CAEBR Myosin-3 OS=Caenorhabditis briggsae GN=myo-3
PE=3 SV=1
Length = 1969

Score = 31.6 bits (70), Expect = 2.2
Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 8/99 (8%)
Frame = -2

Query: 274 LRENSEDRPQRKVPASINTIGGHKLELERKQRLMIAES-----ALRAEDQLQRQISDLQS 110
+R E R Q K NT H+ LE Q + AE+ ALR + +L+ I+DL+
Sbjct: 1581 IRSEIEKRIQEKEEEFENTRRNHQRALESMQATLEAETKQKEEALRIKKKLESDINDLEI 1640

Query: 109 EQQQGPAPDSEMESIVSK---SIREENENLHIKLKQLEE 2
+++ + + K ++RE + + +Q +E
Sbjct: 1641 ALDHANRANADAQKTIKKYMETVRELQVQIEEEQRQKDE 1679


>sp|Q3TDD9|KLRAQ_MOUSE KLRAQ motif-containing protein 1 OS=Mus
musculus GN=Klraq1 PE=2 SV=1
Length = 780

Score = 31.6 bits (70), Expect = 2.2
Identities = 23/86 (26%), Positives = 44/86 (51%)
Frame = -2

Query: 259 EDRPQRKVPASINTIGGHKLELERKQRLMIAESALRAEDQLQRQISDLQSEQQQGPAPDS 80
+D+ RK+ ++++ L+L ++ L+ E AL +E + ++ +S Q S
Sbjct: 48 KDQSLRKLQQEMDSLTFRNLQLAKRVELLQDELAL-SEPRGKKNKKSGESSSQLSQEQKS 106

Query: 79 EMESIVSKSIREENENLHIKLKQLEE 2
+ + K I EENE LHI+ + +E
Sbjct: 107 VFDEDLQKKI-EENERLHIQFFEADE 131


tr_hit_id B4LQ32
Definition tr|B4LQ32|B4LQ32_DROVI GJ21428 OS=Drosophila virilis
Align length 134
Score (bit) 41.6
E-value 0.021
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917346|Adiantum capillus-veneris mRNA, clone:
YMU001_000099_F10.
(503 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4LQ32|B4LQ32_DROVI GJ21428 OS=Drosophila virilis GN=GJ21428 ... 42 0.021
tr|A2FSV7|A2FSV7_TRIVA Putative uncharacterized protein OS=Trich... 40 0.062
tr|B4KM08|B4KM08_DROMO GI18359 OS=Drosophila mojavensis GN=GI183... 40 0.081
tr|B4J4Q3|B4J4Q3_DROGR GH20921 OS=Drosophila grimshawi GN=GH2092... 39 0.11
tr|A2ERV4|A2ERV4_TRIVA Putative uncharacterized protein OS=Trich... 38 0.31
tr|A0CY61|A0CY61_PARTE Chromosome undetermined scaffold_301, who... 38 0.31
tr|Q9SSU1|Q9SSU1_CHACB Unconventional myosin heavy chain OS=Char... 37 0.40
tr|Q9LW97|Q9LW97_CHACB Myosin OS=Chara corallina GN=ccm1 PE=2 SV=1 37 0.40
tr|Q23600|Q23600_CAEEL Protein ZK809.5a, partially confirmed by ... 37 0.40
tr|A7S4B7|A7S4B7_NEMVE Predicted protein OS=Nematostella vectens... 37 0.53
tr|Q7XS27|Q7XS27_ORYSJ OSJNBa0080E14.9 protein OS=Oryza sativa s... 37 0.69
tr|Q0JF51|Q0JF51_ORYSJ Os04g0156200 protein OS=Oryza sativa subs... 37 0.69
tr|A5C436|A5C436_VITVI Putative uncharacterized protein OS=Vitis... 37 0.69
tr|A8FCP7|A8FCP7_BACP2 Hypothetical membrane protein OS=Bacillus... 36 0.90
tr|Q16K19|Q16K19_AEDAE Putative uncharacterized protein OS=Aedes... 36 0.90
tr|B6MFW3|B6MFW3_BRAFL Putative uncharacterized protein OS=Branc... 36 0.90
tr|Q6CJU2|Q6CJU2_KLULA KLLA0F15928p OS=Kluyveromyces lactis GN=K... 36 0.90
tr|Q7S9M2|Q7S9M2_NEUCR Putative uncharacterized protein OS=Neuro... 36 1.2
tr|B6W311|B6W311_9BACE Putative uncharacterized protein OS=Bacte... 35 1.5
tr|A9TKZ9|A9TKZ9_PHYPA Transcription initiation factor TFIID, su... 35 1.5
tr|B2I3J7|B2I3J7_ACIBC Putative uncharacterized protein OS=Acine... 35 2.0
tr|B6K8Q5|B6K8Q5_TOXGO Putative uncharacterized protein OS=Toxop... 35 2.0
tr|B0X1G5|B0X1G5_CULQU Microtubule-associated protein futsch OS=... 35 2.0
tr|B2WMG0|B2WMG0_PYRTR Condensin subunit OS=Pyrenophora tritici-... 35 2.0
tr|Q4S9H3|Q4S9H3_TETNG Chromosome undetermined SCAF14696, whole ... 35 2.6
tr|O68679|O68679_BACME Gas vesicle protein GvpP OS=Bacillus mega... 35 2.6
tr|B7YNJ3|B7YNJ3_VARPD Two component transcriptional regulator, ... 35 2.6
tr|B4AEI6|B4AEI6_BACPU YknX OS=Bacillus pumilus ATCC 7061 GN=BAT... 35 2.6
tr|Q2XY70|Q2XY70_DROYA CG10321 (Fragment) OS=Drosophila yakuba G... 35 2.6
tr|Q22LM1|Q22LM1_TETTH Beige/BEACH domain containing protein OS=... 35 2.6

>tr|B4LQ32|B4LQ32_DROVI GJ21428 OS=Drosophila virilis GN=GJ21428 PE=4
SV=1
Length = 2481

Score = 41.6 bits (96), Expect = 0.021
Identities = 34/134 (25%), Positives = 55/134 (41%)
Frame = -2

Query: 493 PHGSISTTLTWAMGMTREFYIDHASYMFEEMTKLRQDRPNCIAGGEVLTRVIYHAIGAAD 314
P + S + + AM + ++ + M+ L +D T
Sbjct: 977 PDAAESESRSSAMPLLTVDAVEQQQQQLQPMSSLSED-----------TETATETASTFQ 1025

Query: 313 QLPPAPHQNDWLVLRENSEDRPQRKVPASINTIGGHKLELERKQRLMIAESALRAEDQLQ 134
+ PA N L E+ ED P K+P + KL++ER LM+A+ L+ + Q Q
Sbjct: 1026 ETAPAMPANASLNELEDDEDSPALKLPLVLAEFERTKLDIERTMALMVAKRELQEQQQQQ 1085

Query: 133 RQISDLQSEQQQGP 92
RQ+ Q +Q Q P
Sbjct: 1086 RQLQQ-QLQQHQLP 1098


>tr|A2FSV7|A2FSV7_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_398490 PE=4 SV=1
Length = 2861

Score = 40.0 bits (92), Expect = 0.062
Identities = 27/104 (25%), Positives = 51/104 (49%)
Frame = -2

Query: 313 QLPPAPHQNDWLVLRENSEDRPQRKVPASINTIGGHKLELERKQRLMIAESALRAEDQLQ 134
Q P P + R +E+ ++K+ + E +RK I E+ RAE+Q +
Sbjct: 438 QEPQNPIDKSEIARRMRAEEEAKKKLAEEKQKQDNDEEETKRK----IQEAIKRAEEQEK 493

Query: 133 RQISDLQSEQQQGPAPDSEMESIVSKSIREENENLHIKLKQLEE 2
++ + Q +Q+Q E+E+ + + +EE E I+ KQL++
Sbjct: 494 KRKEEEQEKQRQNEKDKQEIENRLKQLQKEEQEKKEIEAKQLQK 537


>tr|B4KM08|B4KM08_DROMO GI18359 OS=Drosophila mojavensis GN=GI18359
PE=4 SV=1
Length = 2388

Score = 39.7 bits (91), Expect = 0.081
Identities = 28/98 (28%), Positives = 46/98 (46%)
Frame = -2

Query: 304 PAPHQNDWLVLRENSEDRPQRKVPASINTIGGHKLELERKQRLMIAESALRAEDQLQRQI 125
P P L ++ ED P K+P + KL++ER L++A+ L+ E QLQ+Q
Sbjct: 956 PVPADVSLNELEDDDEDSPSLKLPHVLAEFERTKLDIERTMALIVAKKELQ-EQQLQKQQ 1014

Query: 124 SDLQSEQQQGPAPDSEMESIVSKSIREENENLHIKLKQ 11
Q ++ Q E+E + ++ E L + KQ
Sbjct: 1015 QQQQQQELQQLQLQRELEQ--QQQQEKQQEQLPAEAKQ 1050


>tr|B4J4Q3|B4J4Q3_DROGR GH20921 OS=Drosophila grimshawi GN=GH20921
PE=4 SV=1
Length = 2595

Score = 39.3 bits (90), Expect = 0.11
Identities = 23/88 (26%), Positives = 45/88 (51%)
Frame = -2

Query: 265 NSEDRPQRKVPASINTIGGHKLELERKQRLMIAESALRAEDQLQRQISDLQSEQQQGPAP 86
+ ED P K+P + KL++ER +M+A+ L+ + QLQ+Q Q +Q Q
Sbjct: 1059 DDEDSPASKLPQVLAEFERTKLDIERTMAIMVAKRQLQQQQQLQQQQQLQQQQQLQQQQQ 1118

Query: 85 DSEMESIVSKSIREENENLHIKLKQLEE 2
+ + + + ++ + L + +QL+E
Sbjct: 1119 LQQQQQLQQQQQLQQQQQLQ-QQQQLQE 1145


>tr|A2ERV4|A2ERV4_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_473080 PE=4 SV=1
Length = 1095

Score = 37.7 bits (86), Expect = 0.31
Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 3/74 (4%)
Frame = -2

Query: 223 NTIGGHKLELERKQRLMIAESALRAEDQLQRQISDLQ---SEQQQGPAPDSEMESIVSKS 53
N + K+E + M ++ E QLQ IS+L+ SE+ P +SE + + +
Sbjct: 825 NNMNHEKIEKLENENKMYSDRCSDLESQLQSMISELRHLKSERDSTPVLNSENVNKIIEG 884

Query: 52 IREENENLHIKLKQ 11
+REEN++L KL +
Sbjct: 885 LREENKDLSEKLSE 898


>tr|A0CY61|A0CY61_PARTE Chromosome undetermined scaffold_301, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00039066001 PE=4 SV=1
Length = 354

Score = 37.7 bits (86), Expect = 0.31
Identities = 35/150 (23%), Positives = 61/150 (40%), Gaps = 8/150 (5%)
Frame = -2

Query: 454 GMTREFYIDHASYMFEEMTKLRQDRPNCIAGGEVLTRVIYHAIGAADQLPPAPHQNDWLV 275
G E ++ FE + K + I G T ++ ++G +Q+D+
Sbjct: 145 GEQNEEHLKKLKIFFENVQKGSTSKFINIYPGMSATETLFSSLG---------NQSDFQA 195

Query: 274 LR-ENSEDRPQRKVPASINTIGGHKLELERKQ----RLMIAESALRAEDQLQRQISDLQS 110
+ E PQ++ + GG ++ + ++ + E A R + QL +QI Q
Sbjct: 196 ESGQQQEQVPQQRTGGQFSEYGGIDPNIDPEMAMIMKMSLEEEAQRLQQQLTQQIQQPQQ 255

Query: 109 EQQQGPAPDSEM---ESIVSKSIREENENL 29
+QQQ P + E V I EEN+ L
Sbjct: 256 QQQQQQQPQQQQQIQEEKVENVIEEENDEL 285


>tr|Q9SSU1|Q9SSU1_CHACB Unconventional myosin heavy chain OS=Chara
corallina GN=ccm PE=2 SV=1
Length = 2167

Score = 37.4 bits (85), Expect = 0.40
Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
Frame = -2

Query: 259 EDRPQRKVPASINTIGGHKLELERK-QRLMIAESALRAEDQ-LQRQISDLQSEQQQGPAP 86
++R R+ S+ + K +L+R Q L ALRAE+Q L++Q+ L+S+ Q
Sbjct: 1057 DNRILRQQALSMKDLELEKQDLQRNLQHLEANSQALRAENQTLKQQLEQLESQDLQRNLQ 1116

Query: 85 DSEMESIVSKSIREENENLHIKLKQLE 5
E S +++R EN+ L +L+QLE
Sbjct: 1117 HLEANS---QALRAENQTLKYQLEQLE 1140



Score = 33.5 bits (75), Expect = 5.8
Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 2/67 (2%)
Frame = -2

Query: 199 ELERK-QRLMIAESALRAEDQ-LQRQISDLQSEQQQGPAPDSEMESIVSKSIREENENLH 26
+L+R Q L ALRAE+Q L++Q+ L+S+ Q E S +++R EN+ L
Sbjct: 1500 DLQRNLQHLEANSQALRAENQTLKQQLEQLESQDLQRNLQHLEANS---QALRAENQTLK 1556

Query: 25 IKLKQLE 5
+L+QLE
Sbjct: 1557 QQLEQLE 1563



Score = 33.1 bits (74), Expect = 7.6
Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 2/67 (2%)
Frame = -2

Query: 199 ELERK-QRLMIAESALRAEDQ-LQRQISDLQSEQQQGPAPDSEMESIVSKSIREENENLH 26
+L+R Q L ALRAE+Q L++Q+ L+S+ Q E + +++R ENE L
Sbjct: 1533 DLQRNLQHLEANSQALRAENQTLKQQLEQLESQDLQRNLQHLEAKC---QALRAENETLK 1589

Query: 25 IKLKQLE 5
+L+QLE
Sbjct: 1590 QQLEQLE 1596



Score = 32.7 bits (73), Expect = 9.9
Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 2/67 (2%)
Frame = -2

Query: 199 ELERK-QRLMIAESALRAEDQ-LQRQISDLQSEQQQGPAPDSEMESIVSKSIREENENLH 26
+L+R Q L ALRAE+Q L+ Q+ L+S+ Q E S +++R EN+ L
Sbjct: 1110 DLQRNLQHLEANSQALRAENQTLKYQLEQLESQDLQRDLQHLEANS---QALRAENQTLK 1166

Query: 25 IKLKQLE 5
+L+QLE
Sbjct: 1167 QQLEQLE 1173


>tr|Q9LW97|Q9LW97_CHACB Myosin OS=Chara corallina GN=ccm1 PE=2 SV=1
Length = 2182

Score = 37.4 bits (85), Expect = 0.40
Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
Frame = -2

Query: 259 EDRPQRKVPASINTIGGHKLELERK-QRLMIAESALRAEDQ-LQRQISDLQSEQQQGPAP 86
++R R+ S+ + K +L+R Q L ALRAE+Q L++Q+ L+S+ Q
Sbjct: 1057 DNRILRQQALSMKDLELEKQDLQRNLQHLEANSQALRAENQTLKQQLEQLESQDLQRNLQ 1116

Query: 85 DSEMESIVSKSIREENENLHIKLKQLE 5
E S +++R EN+ L +L+QLE
Sbjct: 1117 HLEANS---QALRAENQTLKYQLEQLE 1140



Score = 33.5 bits (75), Expect = 5.8
Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 2/67 (2%)
Frame = -2

Query: 199 ELERK-QRLMIAESALRAEDQ-LQRQISDLQSEQQQGPAPDSEMESIVSKSIREENENLH 26
+L+R Q L ALRAE+Q L++Q+ L+S+ Q E S +++R EN+ L
Sbjct: 1500 DLQRNLQHLEANSQALRAENQTLKQQLEQLESQDLQRNLQHLEANS---QALRAENQTLK 1556

Query: 25 IKLKQLE 5
+L+QLE
Sbjct: 1557 QQLEQLE 1563



Score = 33.1 bits (74), Expect = 7.6
Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 2/67 (2%)
Frame = -2

Query: 199 ELERK-QRLMIAESALRAEDQ-LQRQISDLQSEQQQGPAPDSEMESIVSKSIREENENLH 26
+L+R Q L ALRAE+Q L++Q+ L+S+ Q E + +++R ENE L
Sbjct: 1533 DLQRNLQHLEANSQALRAENQTLKQQLEQLESQDLQRNLQHLEAKC---QALRAENETLK 1589

Query: 25 IKLKQLE 5
+L+QLE
Sbjct: 1590 QQLEQLE 1596



Score = 32.7 bits (73), Expect = 9.9
Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 2/67 (2%)
Frame = -2

Query: 199 ELERK-QRLMIAESALRAEDQ-LQRQISDLQSEQQQGPAPDSEMESIVSKSIREENENLH 26
+L+R Q L ALRAE+Q L+ Q+ L+S+ Q E S +++R EN+ L
Sbjct: 1110 DLQRNLQHLEANSQALRAENQTLKYQLEQLESQDLQRDLQHLEANS---QALRAENQTLK 1166

Query: 25 IKLKQLE 5
+L+QLE
Sbjct: 1167 QQLEQLE 1173


>tr|Q23600|Q23600_CAEEL Protein ZK809.5a, partially confirmed by
transcript evidence OS=Caenorhabditis elegans GN=ZK809.5
PE=2 SV=2
Length = 706

Score = 37.4 bits (85), Expect = 0.40
Identities = 31/128 (24%), Positives = 65/128 (50%), Gaps = 10/128 (7%)
Frame = -2

Query: 355 VLTRVIYHAIGAADQLPPAPHQNDWLVLRENSEDR---PQRKVPASINTIGGHKL----- 200
+LTR +Y + ++ Q+PP +V + + D+ P RK ++ H++
Sbjct: 25 ILTRSLYRVLNSSTQVPP------HIVTKSQNVDKMSFPDRKSTIAVARPNNHQIGNASS 78

Query: 199 -ELERKQRLMIAESALRAEDQLQRQISDLQSEQQQGPAPDSEMESIVSKSIREENENLH- 26
+++ + RL+ E R E + +R++ D++ ++ D+E I SIR E E+ +
Sbjct: 79 VDMDMQMRLLAQEICGRVERKYERKLEDVRERDRR----DTERRLI---SIRSEYESKYQ 131

Query: 25 IKLKQLEE 2
++L +LE+
Sbjct: 132 LQLGKLEK 139


>tr|A7S4B7|A7S4B7_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g242763 PE=4 SV=1
Length = 249

Score = 37.0 bits (84), Expect = 0.53
Identities = 23/86 (26%), Positives = 45/86 (52%)
Frame = -2

Query: 349 TRVIYHAIGAADQLPPAPHQNDWLVLRENSEDRPQRKVPASINTIGGHKLELERKQRLMI 170
T++++ + + QLPP H++DW E R + + + IG +L K+RL
Sbjct: 142 TQMMHQCLLSTRQLPPMKHESDW----PEIEQRTTSAIAMARSKIGKEISQL--KERLKA 195

Query: 169 AESALRAEDQLQRQISDLQSEQQQGP 92
+++ + L+ +IS L+ E+ +GP
Sbjct: 196 SKTTIH---NLKTEISRLEQEEDEGP 218