BP917359
Clone id YMU001_000099_G11
Library
Length 548
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000099_G11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AAGCAGCAATGCTAGAGCGCTCAGCAGACTAGTAGCAAACCTCGACACAACCAGGCTGGC
CGCCAACCTCCGACTACAAGCTCCCTTGTGCATCTCATCATCGAACCCGACCAGTGGCGG
TGAGATGAGGAGTCTGACAAAGACGACCACCTGGTGGGCCCCACATCCGGAAACTGGCAT
CTGGGCGCCCGAAGGCGACCTCTTTGCCAGTGTTTCTTCTTCTTCCCCTCTTCTCGACAA
AACAAAGGCCTGGTTTCGCGATGGTGTCCATGCAGACTAATCTCAACAACCGCACGGCAT
GCAACATGTGACTCTGCGCAAGTGCTGTGCATGCCAAACAATCCATGGCAGTCTAGCCAT
GTATATACTAAGTGTTACTGCTTTTCTGCCTTCTGTAAACCCTTCATCAAAGTGCCATTC
ACGAAGAATGCCCTCATGCTGTTGTCACTTGGCGGTGTAGCCATCATCTCAACAAATTTT
CGATAGCTTCTTTCTGATACGAACCACGTTCGTATTTGCATCATAACAACAATTATCGCA
AATTGTCT
■■Homology search results ■■ -
sp_hit_id Q8IX90
Definition sp|Q8IX90|CM003_HUMAN Uncharacterized protein C13orf3 OS=Homo sapiens
Align length 52
Score (bit) 31.6
E-value 2.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917359|Adiantum capillus-veneris mRNA, clone:
YMU001_000099_G11.
(548 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8IX90|CM003_HUMAN Uncharacterized protein C13orf3 OS=Homo sa... 32 2.6
sp|Q9FLN4|RK27_ARATH 50S ribosomal protein L27, chloroplastic OS... 31 3.4
sp|P30155|RK27_TOBAC 50S ribosomal protein L27, chloroplastic OS... 30 5.9

>sp|Q8IX90|CM003_HUMAN Uncharacterized protein C13orf3 OS=Homo
sapiens GN=C13orf3 PE=1 SV=2
Length = 412

Score = 31.6 bits (70), Expect = 2.6
Identities = 19/52 (36%), Positives = 27/52 (51%)
Frame = +1

Query: 349 QSSHVYTKCYCFSAFCKPFIKVPFTKNALMLLSLGGVAIISTNFR*LLSDTN 504
+S YT FC P +K+P TKN+ +A++STN+ LS TN
Sbjct: 275 KSDAEYTNSPLVPTFCTPGLKIPSTKNS--------IALVSTNYP--LSKTN 316


>sp|Q9FLN4|RK27_ARATH 50S ribosomal protein L27, chloroplastic
OS=Arabidopsis thaliana GN=RPL27 PE=1 SV=1
Length = 198

Score = 31.2 bits (69), Expect = 3.4
Identities = 13/35 (37%), Positives = 19/35 (54%)
Frame = -2

Query: 268 DTIAKPGLCFVEKRGRRRNTGKEVAFGRPDASFRM 164
D +AKPG V +RG + + GK V G+ F +
Sbjct: 85 DQVAKPGAIIVRQRGTKFHAGKNVGIGKDHTIFSL 119


>sp|P30155|RK27_TOBAC 50S ribosomal protein L27, chloroplastic
OS=Nicotiana tabacum GN=RPL27 PE=1 SV=1
Length = 179

Score = 30.4 bits (67), Expect = 5.9
Identities = 13/35 (37%), Positives = 19/35 (54%)
Frame = -2

Query: 268 DTIAKPGLCFVEKRGRRRNTGKEVAFGRPDASFRM 164
D +AKPG V +RG + + GK V G+ F +
Sbjct: 78 DQVAKPGSIIVRQRGTKFHPGKNVGLGKDHTIFSL 112


tr_hit_id A9NLF9
Definition tr|A9NLF9|A9NLF9_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 47
Score (bit) 37.4
E-value 0.52
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917359|Adiantum capillus-veneris mRNA, clone:
YMU001_000099_G11.
(548 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NLF9|A9NLF9_PICSI Putative uncharacterized protein OS=Picea... 37 0.52
tr|A3A8N5|A3A8N5_ORYSJ Putative uncharacterized protein OS=Oryza... 36 1.5
tr|A9SBR0|A9SBR0_PHYPA Predicted protein OS=Physcomitrella paten... 35 2.6
tr|A9P9U6|A9P9U6_POPTR Putative uncharacterized protein OS=Popul... 35 2.6
tr|A6XHF7|A6XHF7_TRIRU Carboxypeptidase 2 OS=Trichophyton rubrum... 35 2.6
tr|A3VY83|A3VY83_9RHOB Peptidoglycan binding domain protein OS=R... 35 3.4
tr|Q175C0|Q175C0_AEDAE Putative uncharacterized protein OS=Aedes... 35 3.4
tr|Q30XI7|Q30XI7_DESDG Methyl-accepting chemotaxis sensory trans... 33 7.5
tr|Q16YE7|Q16YE7_AEDAE Low-density lipoprotein receptor (Ldl) OS... 33 7.5
tr|A7T461|A7T461_NEMVE Predicted protein OS=Nematostella vectens... 33 7.5

>tr|A9NLF9|A9NLF9_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=4 SV=1
Length = 113

Score = 37.4 bits (85), Expect = 0.52
Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 7/47 (14%)
Frame = +2

Query: 140 KTTTWWAPHPETGIWAPE-------GDLFASVSSSSPLLDKTKAWFR 259
K+ WW PHP+TG++ P GD S +S + + +AWFR
Sbjct: 56 KSEKWWLPHPKTGVFGPAEEQGWAGGDRHHSRENSDESVLEQQAWFR 102


>tr|A3A8N5|A3A8N5_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_007157 PE=4 SV=1
Length = 138

Score = 35.8 bits (81), Expect = 1.5
Identities = 18/59 (30%), Positives = 30/59 (50%)
Frame = -3

Query: 258 RNQAFVLSRRGEEEETLAKRSPSGAQMPVSGCGAHQVVVFVRLLISPPLVGFDDEMHKG 82
R + VL+ E + +++P G +P++G VVVF+R L + + F M KG
Sbjct: 28 RAHSSVLASASPVLERMIEQAPRGGVVPIAGASTGAVVVFLRFLYAASVSNFKTNMEKG 86


>tr|A9SBR0|A9SBR0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_77207 PE=4 SV=1
Length = 294

Score = 35.0 bits (79), Expect = 2.6
Identities = 12/20 (60%), Positives = 12/20 (60%)
Frame = +2

Query: 137 TKTTTWWAPHPETGIWAPEG 196
TK WW P P TG W PEG
Sbjct: 225 TKQVKWWRPDPVTGAWVPEG 244


>tr|A9P9U6|A9P9U6_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 127

Score = 35.0 bits (79), Expect = 2.6
Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 10/63 (15%)
Frame = +2

Query: 137 TKTTTWWAPHPETGIWAPEGDLFASVSS----------SSPLLDKTKAWFRDGVHAD*SQ 286
T++ +WAPHP TG++ P + S S P+L++ KAWFR D +
Sbjct: 64 TQSDKYWAPHPRTGVFGPATEQHLSEISGDSASVGDGGQDPVLEE-KAWFRPTSLED-LE 121

Query: 287 QPH 295
+PH
Sbjct: 122 KPH 124


>tr|A6XHF7|A6XHF7_TRIRU Carboxypeptidase 2 OS=Trichophyton rubrum
GN=CARB2 PE=2 SV=1
Length = 538

Score = 35.0 bits (79), Expect = 2.6
Identities = 26/72 (36%), Positives = 36/72 (50%), Gaps = 7/72 (9%)
Frame = +2

Query: 110 TSGGEMRSLTKTTTWWAPHPETGIWAPEGD----LFASVSSSS---PLLDKTKAWFRDGV 268
T G MR L ++ +W A H E G + EG ++ S SSSS P K + W + GV
Sbjct: 77 TMEGFMRRLARSNSWMAYH-EAGFKSEEGRKFPYMYLSASSSSVENPSSRKLRVWLQGGV 135

Query: 269 HAD*SQQPHGMQ 304
H + +P G Q
Sbjct: 136 HGN---EPAGDQ 144


>tr|A3VY83|A3VY83_9RHOB Peptidoglycan binding domain protein
OS=Roseovarius sp. 217 GN=ROS217_22842 PE=4 SV=1
Length = 582

Score = 34.7 bits (78), Expect = 3.4
Identities = 13/33 (39%), Positives = 20/33 (60%)
Frame = +2

Query: 167 PETGIWAPEGDLFASVSSSSPLLDKTKAWFRDG 265
PETG+ + EGD F + + + +T+ W RDG
Sbjct: 295 PETGLRSLEGDSFTLIGEGTQKISQTRVWLRDG 327


>tr|Q175C0|Q175C0_AEDAE Putative uncharacterized protein OS=Aedes
aegypti GN=AAEL006716 PE=4 SV=1
Length = 145

Score = 34.7 bits (78), Expect = 3.4
Identities = 23/63 (36%), Positives = 35/63 (55%)
Frame = +2

Query: 44 DTTRLAANLRLQAPLCISSSNPTSGGEMRSLTKTTTWWAPHPETGIWAPEGDLFASVSSS 223
D RL+ + R+Q+PLC S + P+S G+ + LT + HP T + P F++ SS
Sbjct: 43 DPDRLSTSERIQSPLCHSVA-PSSAGQTKVLTISP---RVHPATTLLGPLNSPFSAWDSS 98

Query: 224 SPL 232
S L
Sbjct: 99 SGL 101


>tr|Q30XI7|Q30XI7_DESDG Methyl-accepting chemotaxis sensory
transducer OS=Desulfovibrio desulfuricans (strain G20)
GN=Dde_2814 PE=3 SV=1
Length = 722

Score = 33.5 bits (75), Expect = 7.5
Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 6/72 (8%)
Frame = +2

Query: 2 SSNARALSRLVANLDTTRLAANLRLQAPLCISSSNPT------SGGEMRSLTKTTTWWAP 163
+++ + L R V+ +TT A + R QAPL + S P+ S + L +T T W+
Sbjct: 70 TASEKLLRRAVSAFETTHNALSGRGQAPLSLEPSGPSATLGQPSAATLALLRRTDTLWSQ 129

Query: 164 HPETGIWAPEGD 199
H + A +GD
Sbjct: 130 HKKLVERALKGD 141


>tr|Q16YE7|Q16YE7_AEDAE Low-density lipoprotein receptor (Ldl)
OS=Aedes aegypti GN=AAEL008564 PE=4 SV=1
Length = 664

Score = 33.5 bits (75), Expect = 7.5
Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 6/92 (6%)
Frame = +1

Query: 169 GNWHLGARRRPLCQCFFFFPSSRQNKGLVSRWC----PCRLISTTARHATCDS--AQVLC 330
G +GA RP+C+C F R ++ + +C C L +T R TC + C
Sbjct: 378 GECVVGADSRPMCKCHAEFEGERCDRNICDGYCLNNGRCALSATGQRSCTCSKNFSGARC 437

Query: 331 MPNNPWQSSHVYTKCYCFSAFCKPFIKVPFTK 426
+ + T YC++ C +VP K
Sbjct: 438 -------ETAICTSDYCYNGECFVENEVPECK 462


>tr|A7T461|A7T461_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g222072 PE=4 SV=1
Length = 291

Score = 33.5 bits (75), Expect = 7.5
Identities = 20/42 (47%), Positives = 27/42 (64%), Gaps = 3/42 (7%)
Frame = -3

Query: 426 LREWHFDEGFTEGRKAVTLS---IYMARLPWIVWHAQHLRRV 310
LREWH D+GFTE R AV LS ++ A LP +V + + R+
Sbjct: 104 LREWH-DQGFTELRMAVNLSTVQLHHAELPRVVNNLMQVYRL 144