BP917398
Clone id YMU001_000100_C11
Library
Length 437
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000100_C11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCATAGTTTTCTTTCCTGATGTTGATAATAGATCTTGCAGCCTTTTAGTTGTGGTAGAAA
TGTCTAGTAACTGCTGAGGTTGATTGGATTGCCAGGCGATTTTGTTCCTAGACCCCCAGC
GGAAAGTTTCTGGCGAGTCAGGACGGTCATCATGCATGGTTGTCTTTACTGACGGTGATA
ATAGATCTTGAAGCCTTTTAATTGCGGTAGAGATGTTTAGTACATGCTGAGGCTGATTAG
ACTTCCAGGCGATCTTGATGCTAGACCTTGAGGGAAAAGTTGCTGATAAGTCATTTAGGT
GCCATCAAATCATATCTTCCCCTTAGTCCATAATTCTTGGGAGAATACAAGGCAACGAGC
TGATTTGTTGCTGATCAGTCATTAAGGTGCCAATAAACCATTTTTTCCTCACTCCAATTA
ATTCTTGGGACAATACA
■■Homology search results ■■ -
sp_hit_id Q5R4E0
Definition sp|Q5R4E0|MAT2B_PONAB Methionine adenosyltransferase 2 subunit beta OS=Pongo abelii
Align length 44
Score (bit) 31.2
E-value 2.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917398|Adiantum capillus-veneris mRNA, clone:
YMU001_000100_C11.
(437 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5R4E0|MAT2B_PONAB Methionine adenosyltransferase 2 subunit b... 31 2.0
sp|Q9NZL9|MAT2B_HUMAN Methionine adenosyltransferase 2 subunit b... 31 2.0
sp|Q29RI9|MAT2B_BOVIN Methionine adenosyltransferase 2 subunit b... 31 2.0
sp|Q3UHF7|ZEP2_MOUSE Transcription factor HIVEP2 OS=Mus musculus... 30 4.4
sp|Q8SX83|SPEN_DROME Protein split ends OS=Drosophila melanogast... 30 4.4
sp|A5WGY0|RECA_PSYWF Protein recA OS=Psychrobacter sp. (strain P... 30 4.4
sp|P95469|RECA_PARDE Protein recA OS=Paracoccus denitrificans GN... 30 4.4
sp|Q3BVY2|KATG_XANC5 Catalase-peroxidase OS=Xanthomonas campestr... 30 4.4
sp|Q8PMX4|KATG_XANAC Catalase-peroxidase OS=Xanthomonas axonopod... 30 4.4
sp|A8AKP9|Y2957_CITK8 UPF0255 protein CKO_02957 OS=Citrobacter k... 30 5.7
sp|O94636|TRM11_SCHPO tRNA guanosine-2'-O-methyltransferase trm1... 30 5.7
sp|Q5U2R0|MAT2B_RAT Methionine adenosyltransferase 2 subunit bet... 30 5.7
sp|Q99LB6|MAT2B_MOUSE Methionine adenosyltransferase 2 subunit b... 30 5.7
sp|P74737|RECA_SYNY3 Protein recA OS=Synechocystis sp. (strain P... 29 7.5
sp|A4WV48|RECA_RHOS5 Protein recA OS=Rhodobacter sphaeroides (st... 29 7.5
sp|P32725|RECA_RHOS4 Protein recA OS=Rhodobacter sphaeroides (st... 29 7.5
sp|A3PLJ2|RECA_RHOS1 Protein recA OS=Rhodobacter sphaeroides (st... 29 7.5
sp|P42438|RECA_ACIAD Protein recA OS=Acinetobacter sp. (strain A... 29 7.5
sp|P49293|PSY_CUCME Phytoene synthase, chloroplastic OS=Cucumis ... 29 9.8

>sp|Q5R4E0|MAT2B_PONAB Methionine adenosyltransferase 2 subunit beta
OS=Pongo abelii GN=MAT2B PE=2 SV=1
Length = 334

Score = 31.2 bits (69), Expect = 2.0
Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 2/44 (4%)
Frame = -2

Query: 277 FPSRSSIKIAWKSNQPQHVLNISTAIKRLQD--LLSPSVKTTMH 152
F ++S+ W+ P HV +++T ++L + +L PS+K T H
Sbjct: 206 FSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFH 249


>sp|Q9NZL9|MAT2B_HUMAN Methionine adenosyltransferase 2 subunit beta
OS=Homo sapiens GN=MAT2B PE=1 SV=1
Length = 334

Score = 31.2 bits (69), Expect = 2.0
Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 2/44 (4%)
Frame = -2

Query: 277 FPSRSSIKIAWKSNQPQHVLNISTAIKRLQD--LLSPSVKTTMH 152
F ++S+ W+ P HV +++T ++L + +L PS+K T H
Sbjct: 206 FSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFH 249


>sp|Q29RI9|MAT2B_BOVIN Methionine adenosyltransferase 2 subunit beta
OS=Bos taurus GN=MAT2B PE=2 SV=1
Length = 334

Score = 31.2 bits (69), Expect = 2.0
Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 2/44 (4%)
Frame = -2

Query: 277 FPSRSSIKIAWKSNQPQHVLNISTAIKRLQD--LLSPSVKTTMH 152
F ++S+ W+ P HV +++T ++L + +L PS+K T H
Sbjct: 206 FSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFH 249


>sp|Q3UHF7|ZEP2_MOUSE Transcription factor HIVEP2 OS=Mus musculus
GN=Hivep2 PE=1 SV=1
Length = 2430

Score = 30.0 bits (66), Expect = 4.4
Identities = 21/88 (23%), Positives = 36/88 (40%), Gaps = 12/88 (13%)
Frame = -2

Query: 232 PQHVLNISTAIKRLQDLLSPSVKTTMHDDRPDSP------------ETFRWGSRNKIAWQ 89
PQH + + R ++ P ++ T D+P+ E F+W R++
Sbjct: 862 PQHSYHAQPRLVRQHNIQVPEIRVTEEPDKPEKEKEAPTKEPEKPVEEFQWPQRSETL-- 919

Query: 88 SNQPQQLLDISTTTKRLQDLLSTSGKKT 5
S P + L RL DL +SG+ +
Sbjct: 920 SQLPAEKLPPKKKRLRLADLEHSSGESS 947


>sp|Q8SX83|SPEN_DROME Protein split ends OS=Drosophila melanogaster
GN=spen PE=1 SV=2
Length = 5560

Score = 30.0 bits (66), Expect = 4.4
Identities = 15/65 (23%), Positives = 28/65 (43%)
Frame = -2

Query: 244 KSNQPQHVLNISTAIKRLQDLLSPSVKTTMHDDRPDSPETFRWGSRNKIAWQSNQPQQLL 65
+ Q QH L S + L SP+ + + P + + + RN+ Q P+ +
Sbjct: 3689 QQTQQQHALITSPQSSNISPLASPTTRVLSSSNSPTTSKVNSYQPRNQQVPQQPSPKSVA 3748

Query: 64 DISTT 50
++ TT
Sbjct: 3749 EVQTT 3753


>sp|A5WGY0|RECA_PSYWF Protein recA OS=Psychrobacter sp. (strain
PRwf-1) GN=recA PE=3 SV=1
Length = 349

Score = 30.0 bits (66), Expect = 4.4
Identities = 21/67 (31%), Positives = 32/67 (47%)
Frame = +3

Query: 93 QAILFLDPQRKVSGESGRSSCMVVFTDGDNRS*SLLIAVEMFSTC*G*LDFQAILMLDLE 272
QA L RK++G + RS+CMV+F + ++ +T L F A + LD+
Sbjct: 167 QARLMSQALRKITGNAKRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIR 226

Query: 273 GKVADKS 293
A KS
Sbjct: 227 RIGAVKS 233


>sp|P95469|RECA_PARDE Protein recA OS=Paracoccus denitrificans
GN=recA PE=3 SV=1
Length = 356

Score = 30.0 bits (66), Expect = 4.4
Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 2/68 (2%)
Frame = +3

Query: 93 QAILFLDPQRKVSGESGRSSCMVVFTDGDNRS*SLLIAVEMFSTC*G*LDFQAILMLDLE 272
QA L RK++ GRS+CMV+F + ++ +T L F A + LD+
Sbjct: 179 QARLMSQAMRKLTASIGRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIR 238

Query: 273 --GKVADK 290
G + D+
Sbjct: 239 RAGSIKDR 246


>sp|Q3BVY2|KATG_XANC5 Catalase-peroxidase OS=Xanthomonas campestris
pv. vesicatoria (strain 85-10) GN=katG PE=3 SV=1
Length = 748

Score = 30.0 bits (66), Expect = 4.4
Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 7/43 (16%)
Frame = -2

Query: 115 GSRNKIA----WQSNQPQQLLDISTTTKRLQ---DLLSTSGKK 8
G+R ++A WQ+NQP+QL + T +R+Q + + GKK
Sbjct: 502 GARIRLAPQKDWQANQPEQLAKVLATLERIQADFNAAQSGGKK 544


>sp|Q8PMX4|KATG_XANAC Catalase-peroxidase OS=Xanthomonas axonopodis
pv. citri GN=katG PE=3 SV=2
Length = 748

Score = 30.0 bits (66), Expect = 4.4
Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 7/43 (16%)
Frame = -2

Query: 115 GSRNKIA----WQSNQPQQLLDISTTTKRLQ---DLLSTSGKK 8
G+R ++A WQ+NQP+QL + T +R+Q + + GKK
Sbjct: 502 GARIRLAPQKEWQANQPEQLAKVLATLERIQADFNAAQSGGKK 544


>sp|A8AKP9|Y2957_CITK8 UPF0255 protein CKO_02957 OS=Citrobacter
koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
GN=CKO_02957 PE=3 SV=1
Length = 414

Score = 29.6 bits (65), Expect = 5.7
Identities = 15/51 (29%), Positives = 28/51 (54%)
Frame = -2

Query: 211 STAIKRLQDLLSPSVKTTMHDDRPDSPETFRWGSRNKIAWQSNQPQQLLDI 59
ST ++R PSV++T+ D + P +R +R W+ P+++LD+
Sbjct: 21 STLVRRFNHGTQPSVQSTL--DGKNVPHWYRMINRLMWIWRGIDPREILDV 69


tr_hit_id A7N3A1
Definition tr|A7N3A1|A7N3A1_VIBHB Putative uncharacterized protein OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120)
Align length 72
Score (bit) 36.2
E-value 0.84
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917398|Adiantum capillus-veneris mRNA, clone:
YMU001_000100_C11.
(437 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7N3A1|A7N3A1_VIBHB Putative uncharacterized protein OS=Vibri... 36 0.84
tr|Q2SSH8|Q2SSH8_MYCCT Membrane protein, putative OS=Mycoplasma ... 35 1.9
tr|A9GE61|A9GE61_SORC5 ECF-family RNA polymerase sigma factor OS... 35 1.9
tr|Q6D9K8|Q6D9K8_ERWCT Cfa-beta-ketoacylsynthase OS=Erwinia caro... 34 3.2

>tr|A7N3A1|A7N3A1_VIBHB Putative uncharacterized protein OS=Vibrio
harveyi (strain ATCC BAA-1116 / BB120) GN=VIBHAR_05027
PE=4 SV=1
Length = 336

Score = 36.2 bits (82), Expect = 0.84
Identities = 20/72 (27%), Positives = 34/72 (47%)
Frame = -2

Query: 217 NISTAIKRLQDLLSPSVKTTMHDDRPDSPETFRWGSRNKIAWQSNQPQQLLDISTTTKRL 38
N A K L L++ + TT+H+ D P+ RN +A + ++ + ++ T K
Sbjct: 192 NTDGAYKNLDSLVNDLINTTIHEVHQDDPDLVVLIGRNLVAAEQHRLLESAEVPTEHKAA 251

Query: 37 QDLLSTSGKKTM 2
Q L T KT+
Sbjct: 252 QSLAKTVAGKTV 263


>tr|Q2SSH8|Q2SSH8_MYCCT Membrane protein, putative OS=Mycoplasma
capricolum subsp. capricolum (strain California kid /
ATCC 27343 / NCTC 10154) GN=MCAP_0299 PE=4 SV=1
Length = 1646

Score = 35.0 bits (79), Expect = 1.9
Identities = 23/84 (27%), Positives = 37/84 (44%)
Frame = -2

Query: 343 LPRIMD*GEDMI*WHLNDLSATFPSRSSIKIAWKSNQPQHVLNISTAIKRLQDLLSPSVK 164
LP+I G + + LN T+ S +K+ W+SN P +L ++ IK PS
Sbjct: 608 LPKIDSDGNNTNEFELNSKVRTYIYHSDVKLKWQSNDPTDILLVNGEIK------EPSGN 661

Query: 163 TTMHDDRPDSPETFRWGSRNKIAW 92
T ++ + P RW + W
Sbjct: 662 NTF-EETFNIPLANRWNDETQKEW 684


>tr|A9GE61|A9GE61_SORC5 ECF-family RNA polymerase sigma factor
OS=Sorangium cellulosum (strain So ce56) GN=sce9274 PE=4
SV=1
Length = 361

Score = 35.0 bits (79), Expect = 1.9
Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
Frame = -2

Query: 256 KIAWKSNQPQ-HVLNISTAIKRLQDLLSPSVKTTMHDDRPDSPETFRWGSRNKIAWQ 89
++A +NQ + HV + +R +++L+PS +HD+ P E RW R + W+
Sbjct: 56 RVAIAANQARDHV----RSARRRREVLTPSGDPELHDEHPTPEELLRWREREAVLWE 108


>tr|Q6D9K8|Q6D9K8_ERWCT Cfa-beta-ketoacylsynthase OS=Erwinia
carotovora subsp. atroseptica GN=cfa3 PE=3 SV=1
Length = 381

Score = 34.3 bits (77), Expect = 3.2
Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 14/73 (19%)
Frame = -2

Query: 298 LNDLSATFPSRSS-------IKIAWKSNQPQHVLNISTAIKRLQDLLSP-------SVKT 161
+ DL +T RS+ I + W+ + QHVL + T K L+D P +V
Sbjct: 37 ITDLESTLSLRSNLAAPIPDIPLEWEGARRQHVLTVKTLRKALEDASIPADDPDILAVLG 96

Query: 160 TMHDDRPDSPETF 122
T + DSP+TF
Sbjct: 97 TSYGHHLDSPDTF 109