BP917415
Clone id YMU001_000100_E08
Library
Length 507
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000100_E08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTGGAAGGATCATGAGTATGTCACAAGGCTTTGCGATGCCTAGTTCTCTGCAGGGATCTT
CTAGAACCGTCAAAAACTTCAAATTTTCTGCTGCAACACATGCTTCATGATCAATTCTAT
TAGATAAACTTCGAACAGGTTACAGATAAGGTGATTTGATCTGCTCCAAAAATTTCATGA
TTGACACAATTTCAGGATTGATTAGCTGTACACGTATACCTTCCAAATCAAAACTCCTTT
GGCGCCAAAATGCGACTTCTTCAAGGGGTCCAGAGGCTTCCATGTCAATTATTCGGTCTT
GACCTCTCACAACCTTCTCTCTTTAATTTGACGTGTCCACCGCAACACAATAGATTCAAG
CCGTTGAATCAAATACCTATCCTTCGTTTGTCGAGCCAAATCTCCACCCAATTGCACAGG
TGGAACATACAGCAGTGTCTGTCCTTTTGTCCAAGATAATGATTCGGTAAAGCTTGCCAT
AAATCTATCCAACTCCTCAATGAAGTC
■■Homology search results ■■ -
sp_hit_id Q9MBF8
Definition sp|Q9MBF8|DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii
Align length 106
Score (bit) 94.7
E-value 4.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917415|Adiantum capillus-veneris mRNA, clone:
YMU001_000100_E08.
(507 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9MBF8|DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner... 95 4e-31
sp|Q9P225|DYH2_HUMAN Dynein heavy chain 2, axonemal OS=Homo sapi... 75 2e-13
sp|P0C6F1|DYH2_MOUSE Dynein heavy chain 2, axonemal OS=Mus muscu... 73 9e-13
sp|Q39565|DYHB_CHLRE Dynein beta chain, flagellar outer arm OS=C... 44 9e-10
sp|P39057|DYHC_ANTCR Dynein beta chain, ciliary OS=Anthocidaris ... 35 2e-05
sp|P23098|DYHC_TRIGR Dynein beta chain, ciliary OS=Tripneustes g... 35 4e-05
sp|Q8TE73|DYH5_HUMAN Dynein heavy chain 5, axonemal OS=Homo sapi... 43 7e-04
sp|Q8VHE6|DYH5_MOUSE Dynein heavy chain 5, axonemal OS=Mus muscu... 42 0.002
sp|Q96JB1|DYH8_HUMAN Dynein heavy chain 8, axonemal OS=Homo sapi... 39 0.011
sp|Q9SMH3|DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inne... 39 0.014
sp|Q39575|DYHG_CHLRE Dynein gamma chain, flagellar outer arm OS=... 37 0.040
sp|Q91XQ0|DYH8_MOUSE Dynein heavy chain 8, axonemal OS=Mus muscu... 37 0.053
sp|Q8IVF4|DYH10_HUMAN Dynein heavy chain 10, axonemal OS=Homo sa... 36 0.090
sp|A6YGC4|RK2_LEPTE 50S ribosomal protein L2, chloroplastic OS=L... 32 1.3
sp|O67383|ARLY_AQUAE Argininosuccinate lyase OS=Aquifex aeolicus... 31 3.9
sp|Q38796|LUMI_ARATH Homeobox protein LUMINIDEPENDENS OS=Arabido... 30 6.6

>sp|Q9MBF8|DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner
arm I1 complex OS=Chlamydomonas reinhardtii GN=DHC10
PE=1 SV=1
Length = 4513

Score = 94.7 bits (234), Expect(2) = 4e-31
Identities = 50/106 (47%), Positives = 66/106 (62%)
Frame = -3

Query: 319 EKVVRGQDRIIDMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL* 140
++++ QD + E +GPL E+ FWR+RS DL GIR QL + + SI+ LE KS YL
Sbjct: 216 KELLNQQDSVDASEQAGPLAEIEFWRERSVDLSGIRAQLDDGAVSSIVSVLEYAKSSYLA 275

Query: 139 PVRSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
P SL N I EA A +NLKFL LE+PC++L A P I +LP
Sbjct: 276 PFLSLRNLIHREAVAAEDNLKFLLCLEEPCQQLASAHPQTIPSLLP 321



Score = 59.3 bits (142), Expect(2) = 4e-31
Identities = 28/63 (44%), Positives = 42/63 (66%)
Frame = -1

Query: 507 DFIEELDRFMASFTESLSWTKGQTLLYVPPVQLGGDLARQTKDRYLIQRLESIVLRWTRQ 328
DF ++ +FMA+ TE++ KG+T+LY+P L D K + L+QRLES ++ WTRQ
Sbjct: 156 DFTAQMHKFMANLTETVYEVKGKTILYIPQEDL-RDPKAAAKQKDLVQRLESTIIHWTRQ 214

Query: 327 IKE 319
+KE
Sbjct: 215 VKE 217


>sp|Q9P225|DYH2_HUMAN Dynein heavy chain 2, axonemal OS=Homo sapiens
GN=DNAH2 PE=1 SV=3
Length = 4427

Score = 75.1 bits (183), Expect = 2e-13
Identities = 40/106 (37%), Positives = 58/106 (54%)
Frame = -3

Query: 319 EKVVRGQDRIIDMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL* 140
++++ Q+ + E GPLEE+ FWR R DL GI QL+ + + L KS YL
Sbjct: 257 KEMLSAQETVETGENLGPLEEIEFWRNRCMDLSGISKQLVKKGVKHVESILHLAKSSYLA 316

Query: 139 PVRSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
P L+ +I + A NL FL++L++P +EL KP DI LP
Sbjct: 317 PFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAFMKPKDISSKLP 362



Score = 52.4 bits (124), Expect = 1e-06
Identities = 30/86 (34%), Positives = 47/86 (54%)
Frame = -1

Query: 504 FIEELDRFMASFTESLSWTKGQTLLYVPPVQLGGDLARQTKDRYLIQRLESIVLRWTRQI 325
F L +F+A T++ +G T+LY+P + KD+ L+QRLE+ ++ WTRQI
Sbjct: 197 FASHLHKFLACLTDTRYKLEGHTVLYIPAEAMNMKPEMVIKDKELVQRLETSMIHWTRQI 256

Query: 324 KERRL*EVKTE*LTWKPLDPLKKSHF 247
KE + E T + L PL++ F
Sbjct: 257 KEMLSAQETVE--TGENLGPLEEIEF 280


>sp|P0C6F1|DYH2_MOUSE Dynein heavy chain 2, axonemal OS=Mus musculus
GN=Dnah2 PE=2 SV=1
Length = 4456

Score = 72.8 bits (177), Expect = 9e-13
Identities = 41/106 (38%), Positives = 56/106 (52%)
Frame = -3

Query: 319 EKVVRGQDRIIDMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL* 140
++V+ Q+ + E GPLEE+ FW R DL I QL+ + I L KS YL
Sbjct: 292 KEVLSAQESVETGENLGPLEEIEFWHNRCMDLSSISKQLVKKGVKHIESILFLAKSSYLT 351

Query: 139 PVRSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
P R L+ +I + A NL FL++L +P +EL KP DI LP
Sbjct: 352 PFRKLAQQIQDGSRQAQSNLTFLSILREPYQELAFMKPKDISEKLP 397



Score = 57.8 bits (138), Expect = 3e-08
Identities = 33/86 (38%), Positives = 50/86 (58%)
Frame = -1

Query: 504 FIEELDRFMASFTESLSWTKGQTLLYVPPVQLGGDLARQTKDRYLIQRLESIVLRWTRQI 325
F+ L RF+AS T++ +G T+LY+P + D KD+ L+QRLE+ ++ WTRQI
Sbjct: 232 FVSHLHRFLASLTDTRYKLEGHTVLYIPAEAVQMDPEVVVKDKELVQRLETSMIHWTRQI 291

Query: 324 KERRL*EVKTE*LTWKPLDPLKKSHF 247
KE + E T + L PL++ F
Sbjct: 292 KEVLSAQESVE--TGENLGPLEEIEF 315


>sp|Q39565|DYHB_CHLRE Dynein beta chain, flagellar outer arm
OS=Chlamydomonas reinhardtii GN=ODA4 PE=3 SV=1
Length = 4568

Score = 43.9 bits (102), Expect(2) = 9e-10
Identities = 24/70 (34%), Positives = 37/70 (52%)
Frame = -3

Query: 271 GPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL*PVRSLSNRIDHEACVA 92
GPL E+ FW +R+ +L I QL + + ++K LE KS Y + L ++ A
Sbjct: 232 GPLTELNFWSERAANLNSIHEQLTSEKTQKVVKVLELAKSTYYPAFQRLFREVEAAQQEA 291

Query: 91 AENLKFLTVL 62
+N+KFL L
Sbjct: 292 NDNVKFLKPL 301



Score = 38.1 bits (87), Expect(2) = 9e-10
Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 5/64 (7%)
Frame = -1

Query: 498 EELDRFMASFTESLSWTKGQTLLYVPPVQLGGDL-----ARQTKDRYLIQRLESIVLRWT 334
E L +F+++ ++ KGQTLL +PP L KD+ I LES ++ WT
Sbjct: 150 ENLHKFVSNVFVTIGQMKGQTLLPLPPQNTVPTLQPEQSMHSLKDQDKIHILESAIVTWT 209

Query: 333 RQIK 322
+QIK
Sbjct: 210 KQIK 213


>sp|P39057|DYHC_ANTCR Dynein beta chain, ciliary OS=Anthocidaris
crassispina PE=1 SV=1
Length = 4466

Score = 34.7 bits (78), Expect(2) = 2e-05
Identities = 15/43 (34%), Positives = 28/43 (65%)
Frame = -3

Query: 271 GPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL 143
GP+ E+ FW+ + +L+ I QL +P++ + + LE+ +S YL
Sbjct: 223 GPMVEINFWKAKCENLDCIFQQLRDPKVRKMKELLERTQSSYL 265



Score = 32.7 bits (73), Expect(2) = 2e-05
Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 6/69 (8%)
Frame = -1

Query: 507 DFIEELDRFMASFTESLSWTKGQTLLYVP------PVQLGGDLARQTKDRYLIQRLESIV 346
D + + +S KG+TLL +P G + + DR L+ +ES++
Sbjct: 138 DVLRHVHNLKSSVYVVAGQVKGKTLLPLPVGSEKVETAAGSEEKDDSYDRSLVHAIESVI 197

Query: 345 LRWTRQIKE 319
+ WT QI++
Sbjct: 198 IDWTHQIRD 206


>sp|P23098|DYHC_TRIGR Dynein beta chain, ciliary OS=Tripneustes
gratilla PE=1 SV=1
Length = 4466

Score = 34.7 bits (78), Expect(2) = 4e-05
Identities = 15/43 (34%), Positives = 28/43 (65%)
Frame = -3

Query: 271 GPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL 143
GP+ E+ FW+ + +L+ I QL +P++ + + LE+ +S YL
Sbjct: 223 GPMVEINFWKAKCENLDCIFQQLRDPKVRKMKELLERTQSSYL 265



Score = 31.6 bits (70), Expect(2) = 4e-05
Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 6/69 (8%)
Frame = -1

Query: 507 DFIEELDRFMASFTESLSWTKGQTLLYVPPVQLGGDLARQTK------DRYLIQRLESIV 346
D + + +S KG+TLL +P + A +++ DR L+ +ES++
Sbjct: 138 DVLRHVHNLKSSVYVVAGQVKGKTLLPLPVGSEKVETAAESEEKDDSYDRSLVHAIESVI 197

Query: 345 LRWTRQIKE 319
+ WT QI++
Sbjct: 198 IDWTHQIRD 206


>sp|Q8TE73|DYH5_HUMAN Dynein heavy chain 5, axonemal OS=Homo sapiens
GN=DNAH5 PE=1 SV=3
Length = 4624

Score = 43.1 bits (100), Expect = 7e-04
Identities = 27/107 (25%), Positives = 53/107 (49%), Gaps = 1/107 (0%)
Frame = -3

Query: 319 EKVVRGQDRII-DMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL 143
E+V+ ++++ + + GP E+ W++R + QL +P++ +++ L KS L
Sbjct: 265 EQVLAENNQLLKEADDVGPRAELEHWKKRLSKFNYLLEQLKSPDVKAVLAVLAAAKSKLL 324

Query: 142 *PVRSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
R + RI A +N+K+L LE C L + P ++ +P
Sbjct: 325 KTWREMDIRITDATNEAKDNVKYLYTLEKCCDPLYSSDPLSMMDAIP 371


>sp|Q8VHE6|DYH5_MOUSE Dynein heavy chain 5, axonemal OS=Mus musculus
GN=Dnah5 PE=2 SV=1
Length = 4621

Score = 42.0 bits (97), Expect = 0.002
Identities = 27/90 (30%), Positives = 42/90 (46%)
Frame = -3

Query: 271 GPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL*PVRSLSNRIDHEACVA 92
GP E+ W+QR + QL +P++ + + L KS L R RI A A
Sbjct: 282 GPRAELEHWKQRLSRFNYLLDQLKSPDVKAALALLAAAKSKLLKVWRDTDIRITDAANEA 341

Query: 91 AENLKFLTVLEDPCRELGIAKPCDILMILP 2
+N+K+L LE C L + P ++ +P
Sbjct: 342 KDNVKYLYTLEKCCDPLYSSDPVTMIDAIP 371


>sp|Q96JB1|DYH8_HUMAN Dynein heavy chain 8, axonemal OS=Homo sapiens
GN=DNAH8 PE=1 SV=2
Length = 4490

Score = 39.3 bits (90), Expect = 0.011
Identities = 24/78 (30%), Positives = 37/78 (47%)
Frame = -3

Query: 274 SGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL*PVRSLSNRIDHEACV 95
SGPL E+ W++ S I Q+ P +++ L S L R L RI A
Sbjct: 170 SGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANE 229

Query: 94 AAENLKFLTVLEDPCREL 41
+ +N+++L LE C+ L
Sbjct: 230 SKDNVRYLYTLEKVCQPL 247


>sp|Q9SMH3|DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner
arm I1 complex OS=Chlamydomonas reinhardtii GN=DHC1 PE=1
SV=1
Length = 4625

Score = 38.9 bits (89), Expect = 0.014
Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 2/92 (2%)
Frame = -3

Query: 271 GPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSP--YL*PVRSLSNRIDHEAC 98
GPL E+ FWR+R+ L + QL P++ ++ +E+ + +S + A
Sbjct: 340 GPLAEIEFWRERNAVLSSLYEQLNLPQVKRMILVVEKGSDDRNLMAGFKSQLGELTKLAT 399

Query: 97 VAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
A +N+KFLT LE + + IL LP
Sbjct: 400 EARDNVKFLTTLERHFKNIATGPLGGILDTLP 431


tr_hit_id A8IUF0
Definition tr|A8IUF0|A8IUF0_CHLRE Flagellar inner arm dynein 1 heavy chain beta OS=Chlamydomonas reinhardtii
Align length 106
Score (bit) 94.7
E-value 6.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917415|Adiantum capillus-veneris mRNA, clone:
YMU001_000100_E08.
(507 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8IUF0|A8IUF0_CHLRE Flagellar inner arm dynein 1 heavy chain ... 95 6e-30
tr|A7SQG6|A7SQG6_NEMVE Predicted protein OS=Nematostella vectens... 84 6e-26
tr|B3RUD9|B3RUD9_TRIAD Putative uncharacterized protein OS=Trich... 80 5e-25
tr|B6LNQ1|B6LNQ1_BRAFL Putative uncharacterized protein (Fragmen... 80 8e-23
tr|Q23TU2|Q23TU2_TETTH Dynein heavy chain family protein OS=Tetr... 75 2e-22
tr|B6MV91|B6MV91_BRAFL Putative uncharacterized protein (Fragmen... 80 8e-22
tr|Q57YY8|Q57YY8_9TRYP Dynein heavy chain, putative OS=Trypanoso... 65 1e-20
tr|A0DXN6|A0DXN6_PARTE Chromosome undetermined scaffold_69, whol... 68 2e-19
tr|A0CLT2|A0CLT2_PARTE Chromosome undetermined scaffold_205, who... 67 3e-19
tr|A0BLA3|A0BLA3_PARTE Chromosome undetermined scaffold_113, who... 67 4e-19
tr|Q4QB21|Q4QB21_LEIMA Dynein heavy chain, putative OS=Leishmani... 64 8e-19
tr|A9UUZ7|A9UUZ7_MONBE Predicted protein OS=Monosiga brevicollis... 65 2e-18
tr|A4I0I9|A4I0I9_LEIIN Dynein heavy chain, putative OS=Leishmani... 61 4e-18
tr|A4HD04|A4HD04_LEIBR Dynein heavy chain, putative OS=Leishmani... 59 5e-17
tr|A2FDL6|A2FDL6_TRIVA Dynein heavy chain family protein OS=Tric... 52 1e-13
tr|A0BLA0|A0BLA0_PARTE Chromosome undetermined scaffold_113, who... 67 1e-13
tr|A9TWB3|A9TWB3_PHYPA Predicted protein OS=Physcomitrella paten... 57 1e-12
tr|B3MUB5|B3MUB5_DROAN GF20777 OS=Drosophila ananassae GN=GF2077... 54 9e-12
tr|B6KJ17|B6KJ17_TOXGO Putative uncharacterized protein OS=Toxop... 52 2e-11
tr|B4MZY1|B4MZY1_DROWI GK24293 OS=Drosophila willistoni GN=GK242... 50 4e-11
tr|Q386I6|Q386I6_9TRYP Dynein heavy chain, putative OS=Trypanoso... 45 2e-10
tr|B4NZW0|B4NZW0_DROYA GE14395 OS=Drosophila yakuba GN=GE14395 P... 47 3e-10
tr|Q94709|Q94709_PARTE Outer arm dynein beta heavy chain OS=Para... 57 3e-10
tr|A0DN76|A0DN76_PARTE Chromosome undetermined scaffold_57, whol... 57 3e-10
tr|B4HSV3|B4HSV3_DROSE GM21681 OS=Drosophila sechellia GN=GM2168... 48 3e-10
tr|B4QHW5|B4QHW5_DROSI GD11181 OS=Drosophila simulans GN=GD11181... 48 3e-10
tr|Q4RGA0|Q4RGA0_TETNG Chromosome 12 SCAF15104, whole genome sho... 67 4e-10
tr|B4YLL8|B4YLL8_DROAN Kl-2 1-beta dynein heavy chain OS=Drosoph... 50 4e-10
tr|B3N694|B3N694_DROER GG10461 OS=Drosophila erecta GN=GG10461 P... 46 4e-10
tr|A1ZAD3|A1ZAD3_DROME CG9068 OS=Drosophila melanogaster GN=CG90... 46 1e-09

>tr|A8IUF0|A8IUF0_CHLRE Flagellar inner arm dynein 1 heavy chain
beta OS=Chlamydomonas reinhardtii GN=IDA2 PE=4 SV=1
Length = 4525

Score = 94.7 bits (234), Expect(2) = 6e-30
Identities = 50/106 (47%), Positives = 66/106 (62%)
Frame = -3

Query: 319 EKVVRGQDRIIDMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL* 140
++++ QD + E +GPL E+ FWR+RS DL GIR QL + + SI+ LE KS YL
Sbjct: 216 KELLNQQDSVDASEQAGPLAEIEFWRERSVDLSGIRAQLDDGAVSSIVSVLEYAKSSYLA 275

Query: 139 PVRSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
P SL N I EA A +NLKFL LE+PC++L A P I +LP
Sbjct: 276 PFLSLRNLIHREAVAAEDNLKFLLCLEEPCQQLASAHPQTIPSLLP 321



Score = 59.3 bits (142), Expect(2) = 6e-30
Identities = 28/63 (44%), Positives = 42/63 (66%)
Frame = -1

Query: 507 DFIEELDRFMASFTESLSWTKGQTLLYVPPVQLGGDLARQTKDRYLIQRLESIVLRWTRQ 328
DF ++ +FMA+ TE++ KG+T+LY+P L D K + L+QRLES ++ WTRQ
Sbjct: 156 DFTAQMHKFMANLTETVYEVKGKTILYIPQEDL-RDPKAAAKQKDLVQRLESTIIHWTRQ 214

Query: 327 IKE 319
+KE
Sbjct: 215 VKE 217


>tr|A7SQG6|A7SQG6_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g173194 PE=4 SV=1
Length = 3955

Score = 84.3 bits (207), Expect(2) = 6e-26
Identities = 47/106 (44%), Positives = 59/106 (55%)
Frame = -3

Query: 319 EKVVRGQDRIIDMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL* 140
++V+ QD E SGPLEE+ FWR R DL GI QL P + I LE KS Y+
Sbjct: 83 KEVLSSQDTFETAENSGPLEEIEFWRSRCADLSGISEQLDKPGVKRIQATLELSKSSYVT 142

Query: 139 PVRSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
P LS I + A NLKFL+ L+ PC EL A+P D+ +LP
Sbjct: 143 PFLKLSKLIQDGSSQAQSNLKFLSTLKGPCEELAQAQPKDVPAMLP 188



Score = 56.2 bits (134), Expect(2) = 6e-26
Identities = 25/63 (39%), Positives = 43/63 (68%)
Frame = -1

Query: 507 DFIEELDRFMASFTESLSWTKGQTLLYVPPVQLGGDLARQTKDRYLIQRLESIVLRWTRQ 328
DF+ L +FMA+ T++ +G+T+LYVP ++ + +K++ +QRLE+ ++ WTRQ
Sbjct: 22 DFLAHLHKFMANLTDTRYKMQGKTVLYVPSESTTINIEQASKNKEFVQRLEAAMIHWTRQ 81

Query: 327 IKE 319
IKE
Sbjct: 82 IKE 84


>tr|B3RUD9|B3RUD9_TRIAD Putative uncharacterized protein
OS=Trichoplax adhaerens GN=TRIADDRAFT_23475 PE=4 SV=1
Length = 4324

Score = 80.1 bits (196), Expect(2) = 5e-25
Identities = 44/106 (41%), Positives = 58/106 (54%)
Frame = -3

Query: 319 EKVVRGQDRIIDMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL* 140
++V+ QD + E SGPLEE+ FWR R DL G+ QL P + I LE KS Y+
Sbjct: 165 KEVLSNQDAVETDENSGPLEEIQFWRSRCLDLSGLSEQLDRPGVKRIRDILEHAKSSYVS 224

Query: 139 PVRSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
P LS I + A NLKFL+ L++PC L + P +I LP
Sbjct: 225 PFIRLSKLIQDGSAQAQSNLKFLSTLKEPCLTLSESLPSEISSQLP 270



Score = 57.4 bits (137), Expect(2) = 5e-25
Identities = 28/63 (44%), Positives = 39/63 (61%)
Frame = -1

Query: 507 DFIEELDRFMASFTESLSWTKGQTLLYVPPVQLGGDLARQTKDRYLIQRLESIVLRWTRQ 328
DF + +FMAS T++ G T+LYVP L D K++ L+QRLE+ ++ WTRQ
Sbjct: 104 DFSSQTHKFMASLTDTAHRMDGHTVLYVPDEGLNIDAEAAVKNKELVQRLEASMIHWTRQ 163

Query: 327 IKE 319
IKE
Sbjct: 164 IKE 166


>tr|B6LNQ1|B6LNQ1_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_72756 PE=4 SV=1
Length = 1573

Score = 80.1 bits (196), Expect(2) = 8e-23
Identities = 42/106 (39%), Positives = 61/106 (57%)
Frame = -3

Query: 319 EKVVRGQDRIIDMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL* 140
++V+ QD I + +GPLEE+ FW+ R DL G+ QL P + I + LE KS Y+
Sbjct: 271 KEVLSSQDAIETADNAGPLEEIEFWKSRCDDLSGLSEQLDKPGVKRIQRILELSKSSYVA 330

Query: 139 PVRSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
P ++ I + A NLKFL+ L++PC+ L A P DI +LP
Sbjct: 331 PFLKMARMIQDGSAQAQSNLKFLSSLKEPCQALDEASPKDIPAMLP 376



Score = 50.1 bits (118), Expect(2) = 8e-23
Identities = 24/63 (38%), Positives = 38/63 (60%)
Frame = -1

Query: 507 DFIEELDRFMASFTESLSWTKGQTLLYVPPVQLGGDLARQTKDRYLIQRLESIVLRWTRQ 328
DF +L +F+A+ T++ +G T+LY+P KD+ L+ RLE+ ++ WTRQ
Sbjct: 210 DFSAQLHKFLANLTDTRYKMEGHTVLYIPNEGTSIPPEVAAKDKELVSRLETAMIHWTRQ 269

Query: 327 IKE 319
IKE
Sbjct: 270 IKE 272


>tr|Q23TU2|Q23TU2_TETTH Dynein heavy chain family protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00912290 PE=4
SV=1
Length = 4830

Score = 75.1 bits (183), Expect(2) = 2e-22
Identities = 39/106 (36%), Positives = 63/106 (59%)
Frame = -3

Query: 319 EKVVRGQDRIIDMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL* 140
+++V QD D E +GP +E+ +WR+R +L+ I+ QL+NP++ I++ L+ + S Y+
Sbjct: 343 KEIVNNQDSQQDNENAGPQDEIIYWRRRKNNLQNIQRQLVNPDLQRIIQILKIVDSSYVP 402

Query: 139 PVRSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
L+ I+ + A NL FL L D CR+L A P +I ILP
Sbjct: 403 SFEELTKNINSGSVEAENNLDFLNSLFDSCRQLEKATPREIPSILP 448



Score = 53.5 bits (127), Expect(2) = 2e-22
Identities = 28/63 (44%), Positives = 40/63 (63%)
Frame = -1

Query: 507 DFIEELDRFMASFTESLSWTKGQTLLYVPPVQLGGDLARQTKDRYLIQRLESIVLRWTRQ 328
+FI +L +FMA+ TE+ +G T LY+P L D + D+ LIQRLE+ ++ W RQ
Sbjct: 283 EFIAQLHKFMATLTEASQQNEGYTKLYIPKEDL-SDTQATSLDKDLIQRLETTLIYWYRQ 341

Query: 327 IKE 319
IKE
Sbjct: 342 IKE 344


>tr|B6MV91|B6MV91_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_87148 PE=4 SV=1
Length = 1815

Score = 80.1 bits (196), Expect(2) = 8e-22
Identities = 42/106 (39%), Positives = 61/106 (57%)
Frame = -3

Query: 319 EKVVRGQDRIIDMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL* 140
++V+ QD I + +GPLEE+ FW+ R DL G+ QL P + I + LE KS Y+
Sbjct: 231 KEVLSSQDAIETADNAGPLEEIEFWKSRCDDLSGLSEQLDKPGVKRIQRILELSKSSYVA 290

Query: 139 PVRSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
P ++ I + A NLKFL+ L++PC+ L A P DI +LP
Sbjct: 291 PFLKMARMIQDGSAQAQSNLKFLSSLKEPCQALDEASPKDIPAMLP 336



Score = 46.6 bits (109), Expect(2) = 8e-22
Identities = 22/59 (37%), Positives = 36/59 (61%)
Frame = -1

Query: 495 ELDRFMASFTESLSWTKGQTLLYVPPVQLGGDLARQTKDRYLIQRLESIVLRWTRQIKE 319
+L +F+A+ T++ +G T+LY+P KD+ L+ RLE+ ++ WTRQIKE
Sbjct: 174 QLHKFLANLTDTRYKMEGHTVLYIPNEGTSIPPEVAAKDKELVSRLETAMIHWTRQIKE 232


>tr|Q57YY8|Q57YY8_9TRYP Dynein heavy chain, putative OS=Trypanosoma
brucei GN=Tb927.8.3250 PE=4 SV=1
Length = 4674

Score = 65.1 bits (157), Expect(2) = 1e-20
Identities = 37/107 (34%), Positives = 62/107 (57%), Gaps = 1/107 (0%)
Frame = -3

Query: 319 EKVVRGQDRIIDMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKS-PYL 143
++VV +D + + +GPL+E+A+WR R+ DL IR QL ++ I++ L+ KS YL
Sbjct: 237 KEVVGDKDAGLTGDGAGPLQEIAYWRSRARDLGNIRTQLNRSDVGGIVQVLKNAKSFYYL 296

Query: 142 *PVRSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
P +L ++ A ++L+FL L +PC L A P +I ++P
Sbjct: 297 EPFLNLRADVEKGTDEAFDSLRFLNTLLEPCTRLSRAGPKEIPSLIP 343



Score = 57.8 bits (138), Expect(2) = 1e-20
Identities = 31/64 (48%), Positives = 42/64 (65%), Gaps = 1/64 (1%)
Frame = -1

Query: 507 DFIEELDRFMASFTESLSWTKGQTLLYVPPVQLGG-DLARQTKDRYLIQRLESIVLRWTR 331
D L RFMA+ TE+++ KGQT+LYVP DLA ++R L+Q E++V+ WTR
Sbjct: 175 DVRSALHRFMAAVTENVNRLKGQTVLYVPSDLFSKVDLAEAHQNRELVQGFEAVVIHWTR 234

Query: 330 QIKE 319
QIKE
Sbjct: 235 QIKE 238


>tr|A0DXN6|A0DXN6_PARTE Chromosome undetermined scaffold_69, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00021427001 PE=4 SV=1
Length = 3578

Score = 68.2 bits (165), Expect(2) = 2e-19
Identities = 37/104 (35%), Positives = 61/104 (58%)
Frame = -3

Query: 313 VVRGQDRIIDMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL*PV 134
+V Q+ I+ E +GPL+E+A+WRQR +L I QL PE+ I++ L S Y+
Sbjct: 276 IVNNQELAIENENAGPLDEIAYWRQRKNNLSHIHEQLEKPELKRIIQILSD--SQYVQSF 333

Query: 133 RSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
+ ++ I + A +NL+ L +L +PC++L A P +I +LP
Sbjct: 334 KDVTENIKLGSSQAEDNLENLKILYEPCKQLETATPREIPELLP 377



Score = 50.8 bits (120), Expect(2) = 2e-19
Identities = 26/63 (41%), Positives = 42/63 (66%)
Frame = -1

Query: 507 DFIEELDRFMASFTESLSWTKGQTLLYVPPVQLGGDLARQTKDRYLIQRLESIVLRWTRQ 328
+F+ +L +FMA+ TE +G T LY+P L ++ + + D+ L+QRLE+I+L W RQ
Sbjct: 214 EFLAQLHKFMATLTEFSFSQEGITELYIPNEDLN-NIEQASHDKDLLQRLEAILLHWQRQ 272

Query: 327 IKE 319
IK+
Sbjct: 273 IKD 275


>tr|A0CLT2|A0CLT2_PARTE Chromosome undetermined scaffold_205, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00038674001 PE=4 SV=1
Length = 2796

Score = 67.0 bits (162), Expect(2) = 3e-19
Identities = 36/104 (34%), Positives = 61/104 (58%)
Frame = -3

Query: 313 VVRGQDRIIDMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL*PV 134
+V Q+ I+ E +GPL+E+++WRQR +L I QL PE+ I++ L S Y+
Sbjct: 304 IVNNQELAIENENAGPLDEISYWRQRKNNLSHIHEQLEKPELKRIIQILSD--SQYVQSF 361

Query: 133 RSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
+ ++ I + A +NL+ L +L +PC++L A P +I +LP
Sbjct: 362 KDVTENIKLGSSQAEDNLENLKILYEPCKQLETATPKEIPELLP 405



Score = 50.8 bits (120), Expect(2) = 3e-19
Identities = 26/63 (41%), Positives = 42/63 (66%)
Frame = -1

Query: 507 DFIEELDRFMASFTESLSWTKGQTLLYVPPVQLGGDLARQTKDRYLIQRLESIVLRWTRQ 328
+F+ +L +FMA+ TE +G T LY+P L ++ + + D+ L+QRLE+I+L W RQ
Sbjct: 242 EFLAQLHKFMATLTEYSFSQEGITELYIPNEDLN-NIEQASHDKDLLQRLEAILLHWQRQ 300

Query: 327 IKE 319
IK+
Sbjct: 301 IKD 303


>tr|A0BLA3|A0BLA3_PARTE Chromosome undetermined scaffold_113, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00029952001 PE=4 SV=1
Length = 878

Score = 67.0 bits (162), Expect(2) = 4e-19
Identities = 36/104 (34%), Positives = 61/104 (58%)
Frame = -3

Query: 313 VVRGQDRIIDMEASGPLEEVAFWRQRSFDLEGIRVQLINPEIVSIMKFLEQIKSPYL*PV 134
+V Q+ I+ E +GPL+E+++WRQR +L I QL PE+ I++ L S Y+
Sbjct: 304 IVNNQELAIENENAGPLDEISYWRQRKNNLSHIHEQLEKPELKRIIQILSD--SQYVQSF 361

Query: 133 RSLSNRIDHEACVAAENLKFLTVLEDPCRELGIAKPCDILMILP 2
+ ++ I + A +NL+ L +L +PC++L A P +I +LP
Sbjct: 362 KDVTENIKLGSSQAEDNLENLKILYEPCKQLETATPKEIPELLP 405



Score = 50.8 bits (120), Expect(2) = 4e-19
Identities = 26/63 (41%), Positives = 42/63 (66%)
Frame = -1

Query: 507 DFIEELDRFMASFTESLSWTKGQTLLYVPPVQLGGDLARQTKDRYLIQRLESIVLRWTRQ 328
+F+ +L +FMA+ TE +G T LY+P L ++ + + D+ L+QRLE+I+L W RQ
Sbjct: 242 EFLAQLHKFMATLTEYSFSQEGITELYIPNEDLN-NIEQASHDKDLLQRLEAILLHWQRQ 300

Query: 327 IKE 319
IK+
Sbjct: 301 IKD 303