BP917457
Clone id YMU001_000101_B02
Library
Length 253
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000101_B02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGGTAATACAATGTGGCTCTGCATTGAAAGTGACGAATTAGTACTGGCTGCTTTCAAAAG
ATTTTCTTTGCCACAATTCTTGAGTGTAGAGGAGCTTAATGGTCCTTGAAGAGAAGCTGA
CTTTGCATTCAGAAGGCATCTTCCTGGTGACAAGATAGAATTAGGTCCTGGCAAGTTCCA
TGGATCGCCTGAAGCTGTTTTAGGAAGCAAACCAGACACTTTGATACCCTGGTTGCCATT
CGGTAATGACCTA
■■Homology search results ■■ -
sp_hit_id O32053
Definition sp|O32053|TGT_BACSU Queuine tRNA-ribosyltransferase OS=Bacillus subtilis
Align length 41
Score (bit) 29.3
E-value 6.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917457|Adiantum capillus-veneris mRNA, clone:
YMU001_000101_B02.
(253 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O32053|TGT_BACSU Queuine tRNA-ribosyltransferase OS=Bacillus ... 29 6.3
sp|A8FFQ9|TGT_BACP2 Queuine tRNA-ribosyltransferase OS=Bacillus ... 29 6.3
sp|Q65GP9|TGT_BACLD Queuine tRNA-ribosyltransferase OS=Bacillus ... 29 6.3
sp|A7Z766|TGT_BACA2 Queuine tRNA-ribosyltransferase OS=Bacillus ... 29 6.3
sp|A4FUC9|RHPN2_BOVIN Rhophilin-2 OS=Bos taurus GN=RHPN2 PE=2 SV=1 29 6.3
sp|A4IRA9|TGT_GEOTN Queuine tRNA-ribosyltransferase OS=Geobacill... 29 8.3
sp|Q5KWR4|TGT_GEOKA Queuine tRNA-ribosyltransferase OS=Geobacill... 29 8.3
sp|P54674|PI3K2_DICDI Phosphatidylinositol 3-kinase 2 OS=Dictyos... 29 8.3
sp|A2ATU0|DHTK1_MOUSE Probable 2-oxoglutarate dehydrogenase E1 c... 29 8.3
sp|O14497|ARI1A_HUMAN AT-rich interactive domain-containing prot... 29 8.3
sp|Q8K410|ADA32_MOUSE ADAM 32 OS=Mus musculus GN=Adam32 PE=2 SV=2 29 8.3

>sp|O32053|TGT_BACSU Queuine tRNA-ribosyltransferase OS=Bacillus
subtilis GN=tgt PE=3 SV=1
Length = 381

Score = 29.3 bits (64), Expect = 6.3
Identities = 17/41 (41%), Positives = 22/41 (53%)
Frame = +2

Query: 53 FKRFSLPQFLSVEELNGP*READFAFRRHLPGDKIELGPGK 175
F+ FSL +F ++EE FR HL GDK+ L P K
Sbjct: 100 FQVFSLSKFRNIEE-------EGVHFRNHLNGDKLFLSPEK 133


>sp|A8FFQ9|TGT_BACP2 Queuine tRNA-ribosyltransferase OS=Bacillus
pumilus (strain SAFR-032) GN=tgt PE=3 SV=1
Length = 381

Score = 29.3 bits (64), Expect = 6.3
Identities = 17/41 (41%), Positives = 21/41 (51%)
Frame = +2

Query: 53 FKRFSLPQFLSVEELNGP*READFAFRRHLPGDKIELGPGK 175
F+ FSL +F +EE FR HL GDK+ L P K
Sbjct: 100 FQVFSLSEFRKIEE-------EGVHFRNHLNGDKLFLSPEK 133


>sp|Q65GP9|TGT_BACLD Queuine tRNA-ribosyltransferase OS=Bacillus
licheniformis (strain DSM 13 / ATCC 14580) GN=tgt PE=3
SV=1
Length = 381

Score = 29.3 bits (64), Expect = 6.3
Identities = 17/41 (41%), Positives = 21/41 (51%)
Frame = +2

Query: 53 FKRFSLPQFLSVEELNGP*READFAFRRHLPGDKIELGPGK 175
F+ FSL +F +EE FR HL GDK+ L P K
Sbjct: 100 FQVFSLSEFRKIEE-------EGVHFRNHLNGDKLFLSPEK 133


>sp|A7Z766|TGT_BACA2 Queuine tRNA-ribosyltransferase OS=Bacillus
amyloliquefaciens (strain FZB42) GN=tgt PE=3 SV=1
Length = 381

Score = 29.3 bits (64), Expect = 6.3
Identities = 17/41 (41%), Positives = 22/41 (53%)
Frame = +2

Query: 53 FKRFSLPQFLSVEELNGP*READFAFRRHLPGDKIELGPGK 175
F+ FSL +F ++EE FR HL GDK+ L P K
Sbjct: 100 FQVFSLSKFRNIEE-------EGVHFRNHLNGDKLFLSPEK 133


>sp|A4FUC9|RHPN2_BOVIN Rhophilin-2 OS=Bos taurus GN=RHPN2 PE=2 SV=1
Length = 686

Score = 29.3 bits (64), Expect = 6.3
Identities = 21/67 (31%), Positives = 30/67 (44%)
Frame = -2

Query: 204 PKTASGDPWNLPGPNSILSPGRCLLNAKSASLQGPLSSSTLKNCGKENLLKAASTNSSLS 25
P G+ + G N + GR L + A+L + + G ENLLKAA TN +
Sbjct: 12 PLEKEGNCYFRKGCNPLAQTGRSKLQNQRAALNQQILKAMRMRTGAENLLKAA-TNQKVR 70

Query: 24 MQSHIVL 4
Q + L
Sbjct: 71 EQVRLEL 77


>sp|A4IRA9|TGT_GEOTN Queuine tRNA-ribosyltransferase OS=Geobacillus
thermodenitrificans (strain NG80-2) GN=tgt PE=3 SV=1
Length = 380

Score = 28.9 bits (63), Expect = 8.3
Identities = 17/41 (41%), Positives = 21/41 (51%)
Frame = +2

Query: 53 FKRFSLPQFLSVEELNGP*READFAFRRHLPGDKIELGPGK 175
F+ FSL +F +EE FR HL GDK+ L P K
Sbjct: 99 FQVFSLSEFRRIEE-------EGVYFRNHLNGDKLFLSPEK 132


>sp|Q5KWR4|TGT_GEOKA Queuine tRNA-ribosyltransferase OS=Geobacillus
kaustophilus GN=tgt PE=3 SV=1
Length = 380

Score = 28.9 bits (63), Expect = 8.3
Identities = 17/41 (41%), Positives = 21/41 (51%)
Frame = +2

Query: 53 FKRFSLPQFLSVEELNGP*READFAFRRHLPGDKIELGPGK 175
F+ FSL +F +EE FR HL GDK+ L P K
Sbjct: 99 FQVFSLSEFRRIEE-------EGVYFRNHLNGDKLFLSPEK 132


>sp|P54674|PI3K2_DICDI Phosphatidylinositol 3-kinase 2
OS=Dictyostelium discoideum GN=pikB PE=2 SV=2
Length = 1857

Score = 28.9 bits (63), Expect = 8.3
Identities = 22/72 (30%), Positives = 33/72 (45%)
Frame = -2

Query: 249 SLPNGNQGIKVSGLLPKTASGDPWNLPGPNSILSPGRCLLNAKSASLQGPLSSSTLKNCG 70
++P N G K+S + PK S +P +++ S L+ S+S SSST
Sbjct: 330 NVPTVNGGPKISAV-PKKVSSSKLLIPPSSNVSSSSNITLSLSSSSPSSSSSSSTSTVVP 388

Query: 69 KENLLKAASTNS 34
L + STNS
Sbjct: 389 IVQLSSSNSTNS 400


>sp|A2ATU0|DHTK1_MOUSE Probable 2-oxoglutarate dehydrogenase E1
component DHKTD1, mitochondrial OS=Mus musculus
GN=Dhtkd1 PE=2 SV=1
Length = 921

Score = 28.9 bits (63), Expect = 8.3
Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 6/54 (11%)
Frame = -2

Query: 153 LSPGRCLLN------AKSASLQGPLSSSTLKNCGKENLLKAASTNSSLSMQSHI 10
L PG+ LL+ A +LQGP +++ L N GKE AAS L+ +HI
Sbjct: 77 LFPGQALLDTVPEIQALVRTLQGPFTTTGLLNLGKE----AASLEEVLAYLNHI 126


>sp|O14497|ARI1A_HUMAN AT-rich interactive domain-containing protein
1A OS=Homo sapiens GN=ARID1A PE=1 SV=3
Length = 2285

Score = 28.9 bits (63), Expect = 8.3
Identities = 12/29 (41%), Positives = 18/29 (62%)
Frame = -2

Query: 204 PKTASGDPWNLPGPNSILSPGRCLLNAKS 118
P + DP++ GPN++LSP R +L S
Sbjct: 2095 PSAEAQDPFSTLGPNAVLSPQRLVLETLS 2123


tr_hit_id Q29NS1
Definition tr|Q29NS1|Q29NS1_DROPS Sodium/hydrogen exchanger OS=Drosophila pseudoobscura pseudoobscura
Align length 50
Score (bit) 36.6
E-value 0.65
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917457|Adiantum capillus-veneris mRNA, clone:
YMU001_000101_B02.
(253 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q29NS1|Q29NS1_DROPS Sodium/hydrogen exchanger OS=Drosophila p... 37 0.65
tr|B4GJI2|B4GJI2_DROPE GL25889 OS=Drosophila persimilis GN=GL258... 37 0.65
tr|B6MRT5|B6MRT5_BRAFL Putative uncharacterized protein OS=Branc... 35 2.5
tr|B3MKP6|B3MKP6_DROAN GF14481 OS=Drosophila ananassae GN=GF1448... 33 7.2
tr|Q7S052|Q7S052_NEUCR Predicted protein OS=Neurospora crassa GN... 33 7.2

>tr|Q29NS1|Q29NS1_DROPS Sodium/hydrogen exchanger OS=Drosophila
pseudoobscura pseudoobscura GN=GA21648 PE=3 SV=2
Length = 1416

Score = 36.6 bits (83), Expect = 0.65
Identities = 19/50 (38%), Positives = 25/50 (50%)
Frame = -2

Query: 249 SLPNGNQGIKVSGLLPKTASGDPWNLPGPNSILSPGRCLLNAKSASLQGP 100
S G+ GI +G + TASGDP +P + PG L A S S+ P
Sbjct: 1036 SSKGGSIGIGSTGAVDATASGDPMVVPSSTMMCPPGAALSTAPSTSMHNP 1085


>tr|B4GJI2|B4GJI2_DROPE GL25889 OS=Drosophila persimilis GN=GL25889
PE=4 SV=1
Length = 1248

Score = 36.6 bits (83), Expect = 0.65
Identities = 19/50 (38%), Positives = 25/50 (50%)
Frame = -2

Query: 249 SLPNGNQGIKVSGLLPKTASGDPWNLPGPNSILSPGRCLLNAKSASLQGP 100
S G+ GI +G + TASGDP +P + PG L A S S+ P
Sbjct: 1036 SSKGGSIGIGSTGAVDATASGDPMVVPSSTMMCPPGAALSTAPSTSMHNP 1085


>tr|B6MRT5|B6MRT5_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_85878 PE=4 SV=1
Length = 788

Score = 34.7 bits (78), Expect = 2.5
Identities = 18/41 (43%), Positives = 26/41 (63%)
Frame = -2

Query: 204 PKTASGDPWNLPGPNSILSPGRCLLNAKSASLQGPLSSSTL 82
PKT +PWNLP N ++ P LL AKS+ + PL+++ L
Sbjct: 356 PKTDGFEPWNLPWFNGMIPPP--LLAAKSSFIDPPLAATDL 394


>tr|B3MKP6|B3MKP6_DROAN GF14481 OS=Drosophila ananassae GN=GF14481
PE=4 SV=1
Length = 2643

Score = 33.1 bits (74), Expect = 7.2
Identities = 18/64 (28%), Positives = 31/64 (48%)
Frame = -2

Query: 222 KVSGLLPKTASGDPWNLPGPNSILSPGRCLLNAKSASLQGPLSSSTLKNCGKENLLKAAS 43
K G PKT +P P + +P L +S S P+ S++K +E L K ++
Sbjct: 2225 KAEGPTPKTTKSTVSKIPKPTTEPTPATKKLPLRSKSFSAPMGISSVKRIQQEYLQKQST 2284

Query: 42 TNSS 31
T+++
Sbjct: 2285 TSAA 2288


>tr|Q7S052|Q7S052_NEUCR Predicted protein OS=Neurospora crassa
GN=NCU04851 PE=4 SV=2
Length = 1040

Score = 33.1 bits (74), Expect = 7.2
Identities = 22/70 (31%), Positives = 32/70 (45%)
Frame = -2

Query: 231 QGIKVSGLLPKTASGDPWNLPGPNSILSPGRCLLNAKSASLQGPLSSSTLKNCGKENLLK 52
Q I++ GL P + P P P+S L+P +N S Q P + G +LL
Sbjct: 114 QPIQIPGLTPPS---QPSYQPSPSSALTPSPTAVNPTSQQQQQPHQQQQITLPGPASLLN 170

Query: 51 AASTNSSLSM 22
TN+ LS+
Sbjct: 171 THHTNAYLSV 180