BP917491
Clone id YMU001_000101_E01
Library
Length 550
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000101_E01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAAGAGCTCTATATATGAATAAACAGAAGAGATTGTCACCCATGCAAAAGCATGCGATTA
CTGAACAACCATTTCAGATACAAAGCAAAAACCAGCCATACCCTTTGTACGGCAAGGCGC
GTGTAAATTTACAAGAGGGTTGTATACAAGAGAGGTTGTCCTCCTCAGGGAAACCAGCCC
CACCACCATCCTCCAAAAACACCTACACTATATGGGGTAGTTCTAATGTACAATTGAGGT
CATTACAAGCCCAAGGAACTGGCACATGGACACATTGATGATCCTCATCAAAAAGGGGTC
AATCGCTTCAGCTTGCTTCGCTTACCAATCTCTGCAACCCTCTTTACAAGCTTAGCCACC
ATTGTTAATATCCTGCTTGGTCGACATGCGCTTCAGAAACTCATACGTCGTGATCATCGT
TGTCGCAGACATTGACATTGTGGCCCAGCGAGGACCAAGCCCCTTATAGCATGCTCTCCA
ACCTCCCTCTCTAAAAAGAGTCCTAACCGTCTCTCTTATGCTTGGCCGCTTGTTCTCGTC
ATTTTCCATC
■■Homology search results ■■ -
sp_hit_id P14670
Definition sp|P14670|PYHD_NPVSF Polyhedrin OS=Spodoptera frugiperda nuclear polyhedrosis virus
Align length 40
Score (bit) 30.8
E-value 4.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917491|Adiantum capillus-veneris mRNA, clone:
YMU001_000101_E01.
(550 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P14670|PYHD_NPVSF Polyhedrin OS=Spodoptera frugiperda nuclear... 31 4.5
sp|O60029|PET8_ASHGO Putative mitochondrial carrier protein PET8... 30 6.0

>sp|P14670|PYHD_NPVSF Polyhedrin OS=Spodoptera frugiperda nuclear
polyhedrosis virus GN=PH PE=3 SV=1
Length = 246

Score = 30.8 bits (68), Expect = 4.5
Identities = 12/40 (30%), Positives = 24/40 (60%)
Frame = +3

Query: 6 ALYMNKQKRLSPMQKHAITEQPFQIQSKNQPYPLYGKARV 125
AL+ +++ L P++++ + E PF KNQ L+ + R+
Sbjct: 39 ALHEIEERTLDPLERYVVAEDPFLGPGKNQKLTLFKEIRI 78


>sp|O60029|PET8_ASHGO Putative mitochondrial carrier protein PET8
OS=Ashbya gossypii GN=PET8 PE=3 SV=1
Length = 271

Score = 30.4 bits (67), Expect = 6.0
Identities = 13/28 (46%), Positives = 18/28 (64%)
Frame = -2

Query: 531 KRPSIRETVRTLFREGGWRACYKGLGPR 448
+R + RTLFRE G R ++G+GPR
Sbjct: 222 RRVPMLHLARTLFREEGARVFFRGIGPR 249


tr_hit_id Q10R11
Definition tr|Q10R11|Q10R11_ORYSJ Mitochondrial carrier, putative, expressed OS=Oryza sativa subsp. japonica
Align length 54
Score (bit) 64.7
E-value 3.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917491|Adiantum capillus-veneris mRNA, clone:
YMU001_000101_E01.
(550 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q10R11|Q10R11_ORYSJ Mitochondrial carrier, putative, expresse... 65 3e-09
tr|A3AEN9|A3AEN9_ORYSJ Putative uncharacterized protein OS=Oryza... 65 3e-09
tr|Q0DUP1|Q0DUP1_ORYSJ Os03g0175200 protein OS=Oryza sativa subs... 64 4e-09
tr|A2XD40|A2XD40_ORYSI Putative uncharacterized protein OS=Oryza... 64 4e-09
tr|A9S2A5|A9S2A5_PHYPA Predicted protein OS=Physcomitrella paten... 63 9e-09
tr|A9S2A7|A9S2A7_PHYPA Predicted protein OS=Physcomitrella paten... 62 2e-08
tr|Q9SSP4|Q9SSP4_ARATH F3N23.2 protein (At1g72820/F3N23_2) OS=Ar... 61 3e-08
tr|Q0WN24|Q0WN24_ARATH Putative uncharacterized protein At1g7282... 61 3e-08
tr|A9PJ11|A9PJ11_POPJC Putative uncharacterized protein OS=Popul... 60 8e-08
tr|Q67U56|Q67U56_ORYSJ Mitochondrial substrate carrier-like prot... 59 2e-07
tr|Q0J1F2|Q0J1F2_ORYSJ Os09g0444700 protein (Fragment) OS=Oryza ... 59 2e-07
tr|B8BCG8|B8BCG8_ORYSI Putative uncharacterized protein OS=Oryza... 59 2e-07
tr|A3BZB9|A3BZB9_ORYSJ Putative uncharacterized protein OS=Oryza... 59 2e-07
tr|Q8RU49|Q8RU49_ORYSJ Os10g0397800 protein OS=Oryza sativa subs... 58 3e-07
tr|B8BGP2|B8BGP2_ORYSI Putative uncharacterized protein OS=Oryza... 58 3e-07
tr|A3C4H4|A3C4H4_ORYSJ Putative uncharacterized protein OS=Oryza... 58 3e-07
tr|A7P4R3|A7P4R3_VITVI Chromosome chr4 scaffold_6, whole genome ... 58 4e-07
tr|A5AXB2|A5AXB2_VITVI Putative uncharacterized protein OS=Vitis... 58 4e-07
tr|Q93YZ9|Q93YZ9_ARATH AT5g26200/T19G15_50 OS=Arabidopsis thalia... 56 1e-06
tr|Q8L9F8|Q8L9F8_ARATH Mitochondrial carrier-like protein OS=Ara... 56 1e-06
tr|O81487|O81487_ARATH F9D12.12 protein OS=Arabidopsis thaliana ... 56 1e-06
tr|A9SSH8|A9SSH8_PHYPA Predicted protein OS=Physcomitrella paten... 55 2e-06
tr|B6STR5|B6STR5_MAIZE Mitochondrial carrier-like protein OS=Zea... 53 1e-05
tr|B4FZF1|B4FZF1_MAIZE Putative uncharacterized protein OS=Zea m... 53 1e-05
tr|Q5ZDR4|Q5ZDR4_ORYSJ Putative mitochondrial carrier protein (P... 51 5e-05
tr|A2WPC9|A2WPC9_ORYSI Putative uncharacterized protein OS=Oryza... 51 5e-05
tr|B6TN92|B6TN92_MAIZE Putative uncharacterized protein OS=Zea m... 50 8e-05
tr|B4FH49|B4FH49_MAIZE Putative uncharacterized protein OS=Zea m... 50 8e-05
tr|Q8LKU9|Q8LKU9_SORBI Putative mitochondrial carrier protein OS... 49 2e-04
tr|Q9LFW2|Q9LFW2_ARATH Putative mitochondrial carrier protein OS... 47 5e-04

>tr|Q10R11|Q10R11_ORYSJ Mitochondrial carrier, putative, expressed
OS=Oryza sativa subsp. japonica GN=LOC_Os03g07890 PE=3
SV=1
Length = 435

Score = 64.7 bits (156), Expect = 3e-09
Identities = 28/54 (51%), Positives = 36/54 (66%)
Frame = -2

Query: 528 RPSIRETVRTLFREGGWRACYKGLGPRWXXXXXXXXXXXXTYEFLKRMSTKQDI 367
RP+++ TVR L +EGGW ACY+GLGPRW TYEFLKR+S K+ +
Sbjct: 275 RPTLKSTVRGLLKEGGWAACYRGLGPRWGSMSLSAATMVTTYEFLKRLSAKEGL 328


>tr|A3AEN9|A3AEN9_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_009261 PE=3 SV=1
Length = 345

Score = 64.7 bits (156), Expect = 3e-09
Identities = 28/54 (51%), Positives = 36/54 (66%)
Frame = -2

Query: 528 RPSIRETVRTLFREGGWRACYKGLGPRWXXXXXXXXXXXXTYEFLKRMSTKQDI 367
RP+++ TVR L +EGGW ACY+GLGPRW TYEFLKR+S K+ +
Sbjct: 185 RPTLKSTVRGLLKEGGWAACYRGLGPRWGSMSLSAATMVTTYEFLKRLSAKEGL 238


>tr|Q0DUP1|Q0DUP1_ORYSJ Os03g0175200 protein OS=Oryza sativa subsp.
japonica GN=Os03g0175200 PE=3 SV=1
Length = 323

Score = 64.3 bits (155), Expect = 4e-09
Identities = 28/52 (53%), Positives = 35/52 (67%)
Frame = -2

Query: 528 RPSIRETVRTLFREGGWRACYKGLGPRWXXXXXXXXXXXXTYEFLKRMSTKQ 373
RP+++ TVR L +EGGW ACY+GLGPRW TYEFLKR+S K+
Sbjct: 268 RPTLKSTVRGLLKEGGWAACYRGLGPRWGSMSLSAATMVTTYEFLKRLSAKE 319


>tr|A2XD40|A2XD40_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10224 PE=3 SV=1
Length = 330

Score = 64.3 bits (155), Expect = 4e-09
Identities = 28/52 (53%), Positives = 35/52 (67%)
Frame = -2

Query: 528 RPSIRETVRTLFREGGWRACYKGLGPRWXXXXXXXXXXXXTYEFLKRMSTKQ 373
RP+++ TVR L +EGGW ACY+GLGPRW TYEFLKR+S K+
Sbjct: 275 RPTLKSTVRGLLKEGGWAACYRGLGPRWGSMSLSAATMVTTYEFLKRLSAKE 326


>tr|A9S2A5|A9S2A5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_180532 PE=3 SV=1
Length = 328

Score = 63.2 bits (152), Expect = 9e-09
Identities = 28/60 (46%), Positives = 39/60 (65%)
Frame = -2

Query: 549 MENDENKRPSIRETVRTLFREGGWRACYKGLGPRWXXXXXXXXXXXXTYEFLKRMSTKQD 370
++ + +RPS+R T++TL EGGW+A Y+G+GPRW TYEFLKRMS K +
Sbjct: 268 LKGECGRRPSVRWTLKTLIAEGGWKAFYRGIGPRWCSMSISATTMIVTYEFLKRMSAKAE 327


>tr|A9S2A7|A9S2A7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_162432 PE=3 SV=1
Length = 328

Score = 62.0 bits (149), Expect = 2e-08
Identities = 26/58 (44%), Positives = 38/58 (65%)
Frame = -2

Query: 549 MENDENKRPSIRETVRTLFREGGWRACYKGLGPRWXXXXXXXXXXXXTYEFLKRMSTK 376
+EN+ KR ++ +T++TL ++GGW+A Y+G GPRW TYEFLKR+S K
Sbjct: 268 LENEAGKRATVGQTLKTLVKDGGWKALYRGFGPRWASMSMSATTMITTYEFLKRLSAK 325


>tr|Q9SSP4|Q9SSP4_ARATH F3N23.2 protein (At1g72820/F3N23_2)
OS=Arabidopsis thaliana GN=At1g72820 PE=2 SV=1
Length = 349

Score = 61.2 bits (147), Expect = 3e-08
Identities = 30/56 (53%), Positives = 35/56 (62%)
Frame = -2

Query: 543 NDENKRPSIRETVRTLFREGGWRACYKGLGPRWXXXXXXXXXXXXTYEFLKRMSTK 376
N+ + PSI +TVR L REGGW ACY+GLGPR TYEFLKR+S K
Sbjct: 285 NNGKRGPSIGQTVRNLVREGGWTACYRGLGPRCASMSMSATTMITTYEFLKRLSAK 340


>tr|Q0WN24|Q0WN24_ARATH Putative uncharacterized protein At1g72820
(Fragment) OS=Arabidopsis thaliana GN=At1g72820 PE=2
SV=1
Length = 98

Score = 61.2 bits (147), Expect = 3e-08
Identities = 30/56 (53%), Positives = 35/56 (62%)
Frame = -2

Query: 543 NDENKRPSIRETVRTLFREGGWRACYKGLGPRWXXXXXXXXXXXXTYEFLKRMSTK 376
N+ + PSI +TVR L REGGW ACY+GLGPR TYEFLKR+S K
Sbjct: 34 NNGKRGPSIGQTVRNLVREGGWTACYRGLGPRCASMSMSATTMITTYEFLKRLSAK 89


>tr|A9PJ11|A9PJ11_POPJC Putative uncharacterized protein OS=Populus
jackii PE=2 SV=1
Length = 356

Score = 60.1 bits (144), Expect = 8e-08
Identities = 28/57 (49%), Positives = 36/57 (63%)
Frame = -2

Query: 546 ENDENKRPSIRETVRTLFREGGWRACYKGLGPRWXXXXXXXXXXXXTYEFLKRMSTK 376
EN + ++ +TVR L +EGG+ ACY+GLGPRW TYEFLKR+STK
Sbjct: 293 ENGRTRPLTVMQTVRNLVKEGGFAACYRGLGPRWVSMSMSATTMITTYEFLKRLSTK 349


>tr|Q67U56|Q67U56_ORYSJ Mitochondrial substrate carrier-like protein
OS=Oryza sativa subsp. japonica GN=OJ1123_B08.12 PE=3
SV=1
Length = 245

Score = 58.9 bits (141), Expect = 2e-07
Identities = 27/58 (46%), Positives = 35/58 (60%)
Frame = -2

Query: 549 MENDENKRPSIRETVRTLFREGGWRACYKGLGPRWXXXXXXXXXXXXTYEFLKRMSTK 376
M+ + + ++ TVR L +EGGW ACY+GLGPRW TYEFLKR+S K
Sbjct: 181 MDGEGGEPITVGRTVRRLIKEGGWGACYRGLGPRWASMSLSATTMITTYEFLKRLSAK 238