BP917498
Clone id YMU001_000101_E10
Library
Length 365
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000101_E10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGCTTACAATTTGTTCGAGAAACACCTGTAGAGGTGAAAAACACCCGTCTGTTTGGGGAT
CAGCTACGGCTCCAGCAAGTACTTGCAGACTTCCTAACAACAGCTGTGAGGTTCACCTCA
TCATCTGATGGCTGGGTTGGCATTAGAGTAATACCCACCGTAAAGAATGTTGGAGACCCG
CTTCACGTGGTCAGATTTGAATTCAGGATATCTCATCCAGGGTTCTGGAATCCCTGAAGA
TTCGGTTCAGCAGATGTATGATCGTTCTCAGGAGATCACACAGGAAGGTATGGGGCTCAG
TGTGTCGCAGAAGTTGGTGAAATTGATGAATGGAGATGTGAGTTATGTGCGGGAGGGGGG
AGTTT
■■Homology search results ■■ -
sp_hit_id Q39557
Definition sp|Q39557|PHY2_CERPU Phytochrome 2 OS=Ceratodon purpureus
Align length 74
Score (bit) 105.0
E-value 3.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917498|Adiantum capillus-veneris mRNA, clone:
YMU001_000101_E10.
(332 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q39557|PHY2_CERPU Phytochrome 2 OS=Ceratodon purpureus GN=PHY... 105 3e-31
sp|P36505|PHY1_PHYPA Phytochrome 1 OS=Physcomitrella patens GN=P... 100 5e-30
sp|Q41046|PHY_PINSY Phytochrome OS=Pinus sylvestris PE=2 SV=1 100 9e-30
sp|Q01549|PHY1_SELMA Phytochrome 1 OS=Selaginella martensii GN=P... 95 3e-29
sp|Q40762|PHY_PICAB Phytochrome OS=Picea abies PE=2 SV=1 86 3e-24
sp|P42499|PHYB_SOYBN Phytochrome B OS=Glycine max GN=PHYB PE=3 SV=1 78 4e-22
sp|P29130|PHYB_TOBAC Phytochrome B OS=Nicotiana tabacum GN=PHYB ... 78 2e-21
sp|P33529|PHY_MOUSC Phytochrome OS=Mougeotia scalaris GN=PHY PE=... 76 2e-21
sp|P34094|PHYB_SOLTU Phytochrome B OS=Solanum tuberosum GN=PHYB ... 75 5e-21
sp|Q9ZS62|PHYB1_SOLLC Phytochrome B1 OS=Solanum lycopersicum GN=... 74 8e-21
sp|P93527|PHYB_SORBI Phytochrome B OS=Sorghum bicolor GN=PHYB PE... 72 6e-20
sp|A2XFW2|PHYB_ORYSI Phytochrome B OS=Oryza sativa subsp. indica... 71 3e-19
sp|Q10MG9|PHYB_ORYSJ Phytochrome B OS=Oryza sativa subsp. japoni... 70 5e-19
sp|P93528|PHYC_SORBI Phytochrome C OS=Sorghum bicolor GN=PHYC PE... 72 7e-19
sp|Q10CQ8|PHYC_ORYSJ Phytochrome C OS=Oryza sativa subsp. japoni... 68 2e-17
sp|A2XM23|PHYC_ORYSI Phytochrome C OS=Oryza sativa subsp. indica... 68 2e-17
sp|P14713|PHYB_ARATH Phytochrome B OS=Arabidopsis thaliana GN=PH... 67 3e-17
sp|P42497|PHYD_ARATH Phytochrome D OS=Arabidopsis thaliana GN=PH... 64 4e-17
sp|P42496|PHY_ADICA Phytochrome 1 OS=Adiantum capillus-veneris G... 67 2e-16
sp|P06592|PHYA_CUCPE Phytochrome A OS=Cucurbita pepo GN=PHYA PE=... 63 2e-16
sp|P55141|PHYA_PETCR Phytochrome A OS=Petroselinum crispum GN=PH... 56 8e-16
sp|P55004|PHYE_IPONI Phytochrome E OS=Ipomoea nil GN=PHYE PE=2 SV=1 70 1e-15
sp|P14712|PHYA_ARATH Phytochrome A OS=Arabidopsis thaliana GN=PH... 53 2e-14
sp|P14714|PHYC_ARATH Phytochrome C OS=Arabidopsis thaliana GN=PH... 57 2e-13
sp|P93526|PHYA_SORBI Phytochrome a OS=Sorghum bicolor GN=PHYA PE... 54 9e-13
sp|Q10DU0|PHYA_ORYSJ Phytochrome A OS=Oryza sativa subsp. japoni... 49 2e-12
sp|A2XLG5|PHYA_ORYSI Phytochrome A OS=Oryza sativa subsp. indica... 49 2e-12
sp|P19862|PHYA1_MAIZE Phytochrome A OS=Zea mays GN=PHYA1 PE=3 SV=1 53 3e-12
sp|P15001|PHYA_PEA Phytochrome A OS=Pisum sativum GN=PHYA PE=3 SV=1 50 3e-12
sp|P06594|PHYA4_AVESA Phytochrome A type 4 OS=Avena sativa GN=PH... 49 6e-12

>sp|Q39557|PHY2_CERPU Phytochrome 2 OS=Ceratodon purpureus GN=PHY2
PE=3 SV=1
Length = 1121

Score = 105 bits (261), Expect(2) = 3e-31
Identities = 47/74 (63%), Positives = 59/74 (79%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ +RETP E+ RLFGDQ+RLQQVL+DFL A+RFT SS+GWV I+V+PT K +G
Sbjct: 980 GLQIIRETPREISTMRLFGDQIRLQQVLSDFLINAIRFTPSSEGWVKIKVVPTRKRLGGN 1039

Query: 181 LHVVRFEFRISHPG 222
+HV+ EFR+SHPG
Sbjct: 1040 VHVMHLEFRVSHPG 1053



Score = 49.3 bits (116), Expect(2) = 3e-31
Identities = 20/37 (54%), Positives = 32/37 (86%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G G+P++ V +MYDR++ +TQEG+GL++ +KLV+LMN
Sbjct: 1053 GGGLPDELVLEMYDRAKGMTQEGLGLNMCRKLVRLMN 1089


>sp|P36505|PHY1_PHYPA Phytochrome 1 OS=Physcomitrella patens GN=PHY1
PE=2 SV=1
Length = 1132

Score = 99.8 bits (247), Expect(2) = 5e-30
Identities = 46/74 (62%), Positives = 55/74 (74%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ RETP E+ RL GDQ+RLQQVL+DFL VRFT S +GWV I+V+PT K +G
Sbjct: 982 GLQIFRETPREINTMRLLGDQIRLQQVLSDFLLNTVRFTPSPEGWVKIKVVPTRKRLGGS 1041

Query: 181 LHVVRFEFRISHPG 222
+HVV EFR+SHPG
Sbjct: 1042 VHVVHLEFRVSHPG 1055



Score = 50.4 bits (119), Expect(2) = 5e-30
Identities = 21/37 (56%), Positives = 32/37 (86%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G+G+PE+ V +MYDR + +TQEG+GL++ +KLV+LMN
Sbjct: 1055 GAGLPEELVLEMYDRGKGMTQEGLGLNMCRKLVRLMN 1091


>sp|Q41046|PHY_PINSY Phytochrome OS=Pinus sylvestris PE=2 SV=1
Length = 1131

Score = 100 bits (249), Expect(2) = 9e-30
Identities = 45/78 (57%), Positives = 58/78 (74%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ +RE P EVK RL+GD++++QQ+LADFL +RFT S +GWV I+V PT+K +G
Sbjct: 990 GLQLIREIPGEVKTMRLYGDEVKIQQILADFLLNVLRFTPSPEGWVAIKVFPTLKQLGGG 1049

Query: 181 LHVVRFEFRISHPGFWNP 234
LHVV EFRI+HPG P
Sbjct: 1050 LHVVHLEFRITHPGLGLP 1067



Score = 48.9 bits (115), Expect(2) = 9e-30
Identities = 22/37 (59%), Positives = 30/37 (81%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G G+P + VQ ++DRSQ TQEG+GLS+ +KL+KLMN
Sbjct: 1063 GLGLPAELVQDLFDRSQWATQEGVGLSMCRKLLKLMN 1099


>sp|Q01549|PHY1_SELMA Phytochrome 1 OS=Selaginella martensii GN=PHY1
PE=3 SV=1
Length = 1134

Score = 95.1 bits (235), Expect(2) = 3e-29
Identities = 45/77 (58%), Positives = 57/77 (74%)
Frame = +1

Query: 4 LQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDPL 183
LQ +RETP E+K L+GDQ+RLQQVLADFL A+RFT SS+ WVGI+V + K +G +
Sbjct: 989 LQLIRETPKEIKAMFLYGDQVRLQQVLADFLLNAIRFTPSSENWVGIKVATSRKRLGGVV 1048

Query: 184 HVVRFEFRISHPGFWNP 234
HV+ EFRI+HPG P
Sbjct: 1049 HVMHLEFRITHPGVGLP 1065



Score = 52.8 bits (125), Expect(2) = 3e-29
Identities = 23/37 (62%), Positives = 32/37 (86%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G G+PE+ VQ+M+DR + +TQEG+GLS+ +KLVKLMN
Sbjct: 1061 GVGLPEELVQEMFDRGRGMTQEGLGLSMCRKLVKLMN 1097


>sp|Q40762|PHY_PICAB Phytochrome OS=Picea abies PE=2 SV=1
Length = 1136

Score = 86.3 bits (212), Expect(2) = 3e-24
Identities = 39/74 (52%), Positives = 59/74 (79%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ +R++P E+K L+GDQLRLQQ+L++FL A+RF S+S+GWVG +V+PT +++G
Sbjct: 1000 GLQLIRDSPEEIKTMCLYGDQLRLQQILSNFLINALRF-STSEGWVGNKVVPTKRHLGSG 1058

Query: 181 LHVVRFEFRISHPG 222
++V+ EFRI+H G
Sbjct: 1059 VNVMHMEFRITHSG 1072



Score = 44.7 bits (104), Expect(2) = 3e-24
Identities = 18/37 (48%), Positives = 30/37 (81%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G GIPE+ +++M+ +Q++ QEG+GL + Q+LVK+MN
Sbjct: 1072 GQGIPEELIKEMFVHNQDMFQEGLGLYMCQQLVKIMN 1108


>sp|P42499|PHYB_SOYBN Phytochrome B OS=Glycine max GN=PHYB PE=3 SV=1
Length = 1156

Score = 78.2 bits (191), Expect(2) = 4e-22
Identities = 36/73 (49%), Positives = 49/73 (67%)
Frame = +1

Query: 4 LQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDPL 183
LQ +R+ P E+K ++GDQLR+QQVL+DFL VR+ S DGWV I V P +K + D L
Sbjct: 1018 LQLIRDIPEEIKTLAVYGDQLRIQQVLSDFLLNIVRYAPSPDGWVEIHVRPRIKQISDGL 1077

Query: 184 HVVRFEFRISHPG 222
++ EFR+ PG
Sbjct: 1078 TLLHAEFRMVCPG 1090



Score = 45.4 bits (106), Expect(2) = 4e-22
Identities = 19/37 (51%), Positives = 30/37 (81%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G G+P + +Q M++ S+ TQEG+GLS+S+K++KLMN
Sbjct: 1090 GEGLPPELIQDMFNNSRWGTQEGLGLSMSRKILKLMN 1126


>sp|P29130|PHYB_TOBAC Phytochrome B OS=Nicotiana tabacum GN=PHYB PE=2
SV=2
Length = 1132

Score = 77.8 bits (190), Expect(2) = 2e-21
Identities = 36/73 (49%), Positives = 49/73 (67%)
Frame = +1

Query: 4 LQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDPL 183
+Q +R+ P E+K + GDQ+R+QQVLADFL VR+ S DGWV I++ P +K + D +
Sbjct: 993 VQLIRDIPEEIKTLTVHGDQVRIQQVLADFLLNMVRYAPSPDGWVEIQLQPNMKQISDEV 1052

Query: 184 HVVRFEFRISHPG 222
VV EFRI PG
Sbjct: 1053 TVVHIEFRIVCPG 1065



Score = 43.9 bits (102), Expect(2) = 2e-21
Identities = 18/37 (48%), Positives = 29/37 (78%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G G+P + VQ M+ S+ +T+EG+GLS+ +K++KLMN
Sbjct: 1065 GEGLPPELVQDMFHSSRWVTKEGLGLSMCRKILKLMN 1101


>sp|P33529|PHY_MOUSC Phytochrome OS=Mougeotia scalaris GN=PHY PE=2
SV=2
Length = 1124

Score = 75.9 bits (185), Expect(2) = 2e-21
Identities = 39/73 (53%), Positives = 50/73 (68%)
Frame = +1

Query: 4 LQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDPL 183
LQ +TP + K+ +FGDQ+RLQQVLADFL AV+FT S GWV I+V P VK + +
Sbjct: 983 LQLYCDTPPDFKSLSVFGDQVRLQQVLADFLLNAVQFTPPS-GWVEIKVEPVVKKLPGGV 1041

Query: 184 HVVRFEFRISHPG 222
V +FR+SHPG
Sbjct: 1042 SVANVDFRVSHPG 1054



Score = 45.8 bits (107), Expect(2) = 2e-21
Identities = 21/39 (53%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDR--SQEITQEGMGLSVSQKLVKLMN 331
G G+PED + QM+DR ++ +QEG+GLS+ +KLV+LMN
Sbjct: 1054 GEGLPEDLIDQMFDRADARVKSQEGLGLSICRKLVRLMN 1092


>sp|P34094|PHYB_SOLTU Phytochrome B OS=Solanum tuberosum GN=PHYB PE=3
SV=2
Length = 1130

Score = 74.7 bits (182), Expect(2) = 5e-21
Identities = 35/74 (47%), Positives = 49/74 (66%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
G+Q +R+ P E+K + GDQ+R+QQVLADFL VR+ S DGWV I++ P++ + D
Sbjct: 990 GVQLIRDIPEEIKTLTVHGDQVRIQQVLADFLLNMVRYAPSPDGWVEIQLRPSMMPISDG 1049

Query: 181 LHVVRFEFRISHPG 222
+ VV E RI PG
Sbjct: 1050 VTVVHIELRIICPG 1063



Score = 45.4 bits (106), Expect(2) = 5e-21
Identities = 19/37 (51%), Positives = 29/37 (78%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G G+P + VQ M+ S+ +TQEG+GLS+ +K++KLMN
Sbjct: 1063 GEGLPPELVQDMFHSSRWVTQEGLGLSMCRKMLKLMN 1099


>sp|Q9ZS62|PHYB1_SOLLC Phytochrome B1 OS=Solanum lycopersicum GN=PHYB1
PE=2 SV=1
Length = 1131

Score = 73.9 bits (180), Expect(2) = 8e-21
Identities = 35/74 (47%), Positives = 48/74 (64%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
G+Q +R+ P E+K + GDQ+R+QQVLADFL VR+ S DGWV I++ P++ + D
Sbjct: 991 GVQLIRDIPEEIKTLTVHGDQVRIQQVLADFLLNMVRYAPSPDGWVEIQLRPSMMPISDG 1050

Query: 181 LHVVRFEFRISHPG 222
VV E RI PG
Sbjct: 1051 ATVVHIELRIICPG 1064



Score = 45.4 bits (106), Expect(2) = 8e-21
Identities = 19/37 (51%), Positives = 29/37 (78%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G G+P + VQ M+ S+ +TQEG+GLS+ +K++KLMN
Sbjct: 1064 GEGLPPELVQDMFHSSRWVTQEGLGLSMCRKMLKLMN 1100


tr_hit_id O82148
Definition tr|O82148|O82148_ADICA Phytochrome 2 OS=Adiantum capillus-veneris
Align length 74
Score (bit) 130.0
E-value 5.0e-44
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917498|Adiantum capillus-veneris mRNA, clone:
YMU001_000101_E10.
(332 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|O82148|O82148_ADICA Phytochrome 2 OS=Adiantum capillus-veneri... 130 5e-44
tr|Q40951|Q40951_PSINU Phytochrome (Fragment) OS=Psilotum nudum ... 127 1e-40
tr|B0LI01|B0LI01_CERPU Phytochrome-4 OS=Ceratodon purpureus PE=4... 110 8e-33
tr|A9SLL8|A9SLL8_PHYPA Phytochrome 5b3 OS=Physcomitrella patens ... 106 2e-31
tr|A9T4N3|A9T4N3_PHYPA Phytochrome 4 OS=Physcomitrella patens su... 107 2e-31
tr|A9TUP7|A9TUP7_PHYPA Phytochrome 2 OS=Physcomitrella patens su... 109 6e-31
tr|Q8GV70|Q8GV70_PHYPA Phytochrome OS=Physcomitrella patens GN=p... 108 8e-31
tr|Q8GV72|Q8GV72_PHYPA Phytochrome OS=Physcomitrella patens GN=p... 105 1e-30
tr|Q8GV68|Q8GV68_CERPU Phytochrome OS=Ceratodon purpureus GN=phy... 103 1e-30
tr|A9S4A1|A9S4A1_PHYPA Phytochrome 5a OS=Physcomitrella patens s... 104 2e-30
tr|O24446|O24446_CERPU Phytochrome photoreceptor OS=Ceratodon pu... 105 6e-30
tr|A9RK23|A9RK23_PHYPA Phytochrome 5c OS=Physcomitrella patens s... 100 2e-29
tr|Q8GV69|Q8GV69_PHYPA Phytochrome OS=Physcomitrella patens GN=p... 102 5e-29
tr|A9SID1|A9SID1_PHYPA Phytochrome 3 OS=Physcomitrella patens su... 102 5e-29
tr|Q8GV71|Q8GV71_PHYPA Phytochrome OS=Physcomitrella patens GN=p... 100 9e-29
tr|A9THP5|A9THP5_PHYPA Phytochrome 1 OS=Physcomitrella patens su... 100 9e-29
tr|Q9AVP3|Q9AVP3_MARPA Phytochrome OS=Marchantia paleacea var. d... 95 4e-27
tr|A2Q2V6|A2Q2V6_MEDTR GAF; Heavy metal sensor kinase OS=Medicag... 80 3e-22
tr|Q9SEW2|Q9SEW2_PEA Phytochrome B (Fragment) OS=Pisum sativum G... 79 8e-22
tr|B4YB12|B4YB12_SOYBN Phytochrome B-3 OS=Glycine max GN=phyB PE... 78 7e-21
tr|B4YB10|B4YB10_SOYBN Phytochrome B-1 OS=Glycine max GN=phyB PE... 78 7e-21
tr|A7Q305|A7Q305_VITVI Chromosome chr12 scaffold_47, whole genom... 73 9e-21
tr|Q3V8G6|Q3V8G6_MOUSC Phytochrome OS=Mougeotia scalaris GN=PHY1... 77 1e-20
tr|B4YB11|B4YB11_SOYBN Phytochrome B-2 OS=Glycine max GN=phyB PE... 78 2e-20
tr|Q717V7|Q717V7_STELP Phytochrome B OS=Stellaria longipes GN=PH... 75 3e-20
tr|O24117|O24117_NICPL Phytochrome B OS=Nicotiana plumbaginifoli... 78 6e-20
tr|Q41335|Q41335_SOLLC Phytochrome F OS=Solanum lycopersicum GN=... 75 1e-19
tr|A7Q8Q6|A7Q8Q6_VITVI Chromosome chr5 scaffold_64, whole genome... 77 2e-19
tr|Q9FSD5|Q9FSD5_PINSY Phytochrome N (Fragment) OS=Pinus sylvest... 74 3e-19
tr|Q2L9Z2|Q2L9Z2_SOLTU Phytochrome B OS=Solanum tuberosum PE=2 SV=1 72 6e-19

>tr|O82148|O82148_ADICA Phytochrome 2 OS=Adiantum capillus-veneris
GN=PHY2 PE=2 SV=1
Length = 1140

Score = 130 bits (326), Expect(2) = 5e-44
Identities = 59/74 (79%), Positives = 68/74 (91%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ +RET VE+KNTRLFGDQ RLQQVLADFLTTA+RFTSSSDGWVGI+V+PT+KN+ D
Sbjct: 1004 GLQLIRETHVEIKNTRLFGDQYRLQQVLADFLTTAIRFTSSSDGWVGIKVVPTIKNMKDG 1063

Query: 181 LHVVRFEFRISHPG 222
LH+V FEFR+SHPG
Sbjct: 1064 LHIVHFEFRVSHPG 1077



Score = 71.2 bits (173), Expect(2) = 5e-44
Identities = 35/37 (94%), Positives = 36/37 (97%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
GSGIPED VQQMYDRSQEITQEGMGLSVS+KLVKLMN
Sbjct: 1077 GSGIPEDLVQQMYDRSQEITQEGMGLSVSRKLVKLMN 1113


>tr|Q40951|Q40951_PSINU Phytochrome (Fragment) OS=Psilotum nudum
GN=psphy PE=2 SV=1
Length = 794

Score = 127 bits (320), Expect(2) = 1e-40
Identities = 58/74 (78%), Positives = 69/74 (93%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ +RETPV++KN RL+GDQLRLQQVLADFLTTAVRFTSSSDGWVGI+V+PT+K +G
Sbjct: 655 GLQLIRETPVDIKNMRLYGDQLRLQQVLADFLTTAVRFTSSSDGWVGIKVVPTMKGLGGG 714

Query: 181 LHVVRFEFRISHPG 222
LHV+RF++RISHPG
Sbjct: 715 LHVMRFDYRISHPG 728



Score = 62.4 bits (150), Expect(2) = 1e-40
Identities = 30/37 (81%), Positives = 34/37 (91%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G GIPED VQQM+D S+EITQEGMGLSVS+KLV+LMN
Sbjct: 728 GKGIPEDLVQQMFDCSREITQEGMGLSVSRKLVRLMN 764


>tr|B0LI01|B0LI01_CERPU Phytochrome-4 OS=Ceratodon purpureus PE=4 SV=1
Length = 1125

Score = 110 bits (275), Expect(2) = 8e-33
Identities = 51/74 (68%), Positives = 60/74 (81%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ +RETP E+KN LFGDQ+RLQQVLADFL AVRFT SS+GWVGI+V+PT K +G
Sbjct: 984 GLQLIRETPREIKNMCLFGDQVRLQQVLADFLLNAVRFTPSSEGWVGIKVVPTKKRLGGG 1043

Query: 181 LHVVRFEFRISHPG 222
HVV EFR++HPG
Sbjct: 1044 FHVVHLEFRVTHPG 1057



Score = 53.1 bits (126), Expect(2) = 8e-33
Identities = 23/37 (62%), Positives = 32/37 (86%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
GSG+PE+ V +M+DR + +TQEG+GLS+ +KLVKLMN
Sbjct: 1057 GSGLPEELVHEMFDRGRGMTQEGLGLSMCRKLVKLMN 1093


>tr|A9SLL8|A9SLL8_PHYPA Phytochrome 5b3 OS=Physcomitrella patens
subsp. patens GN=PHY5b PE=4 SV=1
Length = 1131

Score = 106 bits (264), Expect(2) = 2e-31
Identities = 49/74 (66%), Positives = 59/74 (79%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ +RETP E++ LFGDQ+RLQQVLADFL AVRFT SS+GWVGI+V+PT K +G
Sbjct: 983 GLQLIRETPREIQGMCLFGDQVRLQQVLADFLLNAVRFTPSSEGWVGIKVVPTRKRLGGG 1042

Query: 181 LHVVRFEFRISHPG 222
HVV EFR++HPG
Sbjct: 1043 FHVVHLEFRVTHPG 1056



Score = 53.1 bits (126), Expect(2) = 2e-31
Identities = 23/37 (62%), Positives = 32/37 (86%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
GSG+PE+ V +M+DR + +TQEG+GLS+ +KLVKLMN
Sbjct: 1056 GSGLPEELVHEMFDRGRGMTQEGLGLSMCRKLVKLMN 1092


>tr|A9T4N3|A9T4N3_PHYPA Phytochrome 4 OS=Physcomitrella patens subsp.
patens GN=PHY4 PE=4 SV=1
Length = 1126

Score = 107 bits (268), Expect(2) = 2e-31
Identities = 50/78 (64%), Positives = 61/78 (78%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ +RETP E+KN LFGDQ+RLQQVLADFL AVRFT SS+GWVGI+V+PT K +G
Sbjct: 985 GLQLIRETPREIKNMCLFGDQVRLQQVLADFLLNAVRFTPSSEGWVGIKVVPTKKRLGGG 1044

Query: 181 LHVVRFEFRISHPGFWNP 234
+HV+ EFR++H G P
Sbjct: 1045 IHVMHLEFRVTHSGMGLP 1062



Score = 51.2 bits (121), Expect(2) = 2e-31
Identities = 22/37 (59%), Positives = 31/37 (83%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G G+PE+ V +M+DR + +TQEG+GLS+ +KLVKLMN
Sbjct: 1058 GMGLPEELVHEMFDRGRGMTQEGLGLSMCRKLVKLMN 1094


>tr|A9TUP7|A9TUP7_PHYPA Phytochrome 2 OS=Physcomitrella patens subsp.
patens GN=PHY2 PE=4 SV=1
Length = 1130

Score = 109 bits (272), Expect(2) = 6e-31
Identities = 50/78 (64%), Positives = 62/78 (79%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ +RETP E+KN L+GDQ+RLQQVLADFL AVRFT SS+GWVGI+V+PT K +G
Sbjct: 985 GLQLIRETPSEIKNMCLYGDQVRLQQVLADFLLNAVRFTPSSEGWVGIKVVPTKKRLGRG 1044

Query: 181 LHVVRFEFRISHPGFWNP 234
+HV+ EFR++HPG P
Sbjct: 1045 VHVMHLEFRVTHPGLGLP 1062



Score = 48.1 bits (113), Expect(2) = 6e-31
Identities = 21/37 (56%), Positives = 30/37 (81%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G G+PE+ V +M+ R + +TQEG+GLS+ +KLVKLMN
Sbjct: 1058 GLGLPEELVHEMFGRGRGMTQEGLGLSMCRKLVKLMN 1094


>tr|Q8GV70|Q8GV70_PHYPA Phytochrome OS=Physcomitrella patens GN=phy2
PE=4 SV=1
Length = 1130

Score = 108 bits (271), Expect(2) = 8e-31
Identities = 50/78 (64%), Positives = 62/78 (79%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ +RETP E+KN L+GDQ+RLQQVLADFL AVRFT SS+GWVGI+V+PT K +G
Sbjct: 985 GLQLIRETPSEIKNMCLYGDQVRLQQVLADFLLNAVRFTPSSEGWVGIKVVPTKKRLGRG 1044

Query: 181 LHVVRFEFRISHPGFWNP 234
+HV+ EFR++HPG P
Sbjct: 1045 VHVMHVEFRVTHPGLGLP 1062



Score = 48.1 bits (113), Expect(2) = 8e-31
Identities = 21/37 (56%), Positives = 30/37 (81%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G G+PE+ V +M+ R + +TQEG+GLS+ +KLVKLMN
Sbjct: 1058 GLGLPEELVHEMFGRGRGMTQEGLGLSMCRKLVKLMN 1094


>tr|Q8GV72|Q8GV72_PHYPA Phytochrome OS=Physcomitrella patens GN=phy4
PE=4 SV=1
Length = 1126

Score = 105 bits (262), Expect(2) = 1e-30
Identities = 49/78 (62%), Positives = 60/78 (76%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ +RETP E+KN LFGDQ+RLQQVLADFL AV+FT SS GWVGI+V+PT K +G
Sbjct: 985 GLQLIRETPREIKNMCLFGDQVRLQQVLADFLLNAVKFTPSSGGWVGIKVVPTKKRLGGG 1044

Query: 181 LHVVRFEFRISHPGFWNP 234
+HV+ EFR++H G P
Sbjct: 1045 IHVMHLEFRVTHSGMGLP 1062



Score = 51.2 bits (121), Expect(2) = 1e-30
Identities = 22/37 (59%), Positives = 31/37 (83%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
G G+PE+ V +M+DR + +TQEG+GLS+ +KLVKLMN
Sbjct: 1058 GMGLPEELVHEMFDRGRGMTQEGLGLSMCRKLVKLMN 1094


>tr|Q8GV68|Q8GV68_CERPU Phytochrome OS=Ceratodon purpureus GN=phy3
PE=4 SV=1
Length = 1126

Score = 103 bits (256), Expect(2) = 1e-30
Identities = 47/74 (63%), Positives = 57/74 (77%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ +RETP E+ + LFGDQ+RLQ VLADFL AVR T SS+GWVGI+V+PT K +G
Sbjct: 985 GLQLIRETPREINDMSLFGDQVRLQHVLADFLLNAVRLTPSSEGWVGIKVVPTKKRLGGG 1044

Query: 181 LHVVRFEFRISHPG 222
HVV EFR++HPG
Sbjct: 1045 FHVVHLEFRVAHPG 1058



Score = 53.1 bits (126), Expect(2) = 1e-30
Identities = 23/37 (62%), Positives = 32/37 (86%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
GSG+PE+ V +M+DR + +TQEG+GLS+ +KLVKLMN
Sbjct: 1058 GSGLPEELVHEMFDRGRGMTQEGLGLSMCRKLVKLMN 1094


>tr|A9S4A1|A9S4A1_PHYPA Phytochrome 5a OS=Physcomitrella patens subsp.
patens GN=PHY5a PE=4 SV=1
Length = 1123

Score = 104 bits (259), Expect(2) = 2e-30
Identities = 48/74 (64%), Positives = 59/74 (79%)
Frame = +1

Query: 1 GLQFVRETPVEVKNTRLFGDQLRLQQVLADFLTTAVRFTSSSDGWVGIRVIPTVKNVGDP 180
GLQ +RETP E+K+ LFGDQ+RLQQVLADFL AVRFT SS+GWVGI+V+ T + +G
Sbjct: 982 GLQLIRETPREIKDMCLFGDQVRLQQVLADFLLNAVRFTPSSEGWVGIKVVATKRRLGGG 1041

Query: 181 LHVVRFEFRISHPG 222
HVV EFR++HPG
Sbjct: 1042 FHVVHLEFRVTHPG 1055



Score = 51.6 bits (122), Expect(2) = 2e-30
Identities = 21/37 (56%), Positives = 32/37 (86%)
Frame = +2

Query: 221 GSGIPEDSVQQMYDRSQEITQEGMGLSVSQKLVKLMN 331
GSG+PE+ + +M+DR + +TQEG+GL++ +KLVKLMN
Sbjct: 1055 GSGLPEELIHEMFDRGRGMTQEGLGLNMCRKLVKLMN 1091