BP917504
Clone id YMU001_000101_F06
Library
Length 502
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000101_F06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AACTGGAAGATTCGCGGCCGCGAATTCTTCCAATTTTCTTTTTTTTTTCTTTTAACATCG
CACTTGGTAGTAGTTATTAGTGTCTTAAGCTCGTAAAACGCGATGAGACAAACAAAAGCA
AGACCGAGATCTCTGATCTTAGTGCATTGGCAGTGCCATATGAAAAAAAAACACACACAC
ACACACAATTCTATTTTGAGAATCACCTATATACATTTTTTGTGACAACTCCTAGAGGTA
TTCATACTTGTTCTTTTAGGTGCAAAGACGACATCCAAGGGTGGAACCCTCACCCCACCC
CACGTAAGAGGGCTCCCAACCTATTTGTTGGCTATGCACATTCACTTTTGTTCATATTTG
TCGAGCTTGGTATTCTGGAGCCAATATTCTAGCATTTTGTGACCTTCTTTGTACTCCGCA
AGCACACGCTTGATTTTCTCAAACTTCTCGGCTTGCTTGCGCAATTTCTCCAAAAGTTCC
AAGTCCCTTTGTCTCATGTACA
■■Homology search results ■■ -
sp_hit_id Q6P5F6
Definition sp|Q6P5F6|S39AA_MOUSE Zinc transporter ZIP10 OS=Mus musculus
Align length 70
Score (bit) 33.9
E-value 0.33
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917504|Adiantum capillus-veneris mRNA, clone:
YMU001_000101_F06.
(449 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6P5F6|S39AA_MOUSE Zinc transporter ZIP10 OS=Mus musculus GN=... 34 0.33
sp|Q54PT3|C556A_DICDI Probable cytochrome P450 556A1 OS=Dictyost... 33 0.56
sp|Q8NF91|SYNE1_HUMAN Nesprin-1 OS=Homo sapiens GN=SYNE1 PE=1 SV=2 31 2.1
sp|Q96AA8|JKIP2_HUMAN Janus kinase and microtubule-interacting p... 31 2.8
sp|Q646F6|TA2R7_PAPHA Taste receptor type 2 member 7 OS=Papio ha... 30 3.6
sp|Q645T7|TA2R7_MACMU Taste receptor type 2 member 7 OS=Macaca m... 30 4.7
sp|B2KIE9|SEPT8_RHIFE Septin-8 OS=Rhinolophus ferrumequinum GN=S... 30 4.7
sp|B5FW69|SEPT8_OTOGA Septin-8 OS=Otolemur garnettii GN=SEPT8 PE... 30 4.7
sp|Q92599|SEPT8_HUMAN Septin-8 OS=Homo sapiens GN=SEPT8 PE=1 SV=4 30 4.7
sp|B1MTN8|SEPT8_CALMO Septin-8 OS=Callicebus moloch GN=SEPT8 PE=... 30 4.7
sp|B0KWP7|SEPT8_CALJA Septin-8 OS=Callithrix jacchus GN=SEPT8 PE... 30 4.7
sp|P46935|NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus m... 30 4.7
sp|Q646C4|TA2R7_PANTR Taste receptor type 2 member 7 (Fragment) ... 30 6.1
sp|Q646D6|TA2R7_PANPA Taste receptor type 2 member 7 OS=Pan pani... 30 6.1
sp|Q54KB8|SYEC_DICDI Probable glutamyl-tRNA synthetase, cytoplas... 30 6.1
sp|B0BNF1|SEPT8_RAT Septin-8 OS=Rattus norvegicus GN=Sept8 PE=1 ... 30 6.1
sp|Q8CHH9|SEPT8_MOUSE Septin-8 OS=Mus musculus GN=Sept8 PE=1 SV=4 30 6.1
sp|Q9V297|MALE_PYRAB Maltotriose-binding protein OS=Pyrococcus a... 30 6.1
sp|Q5JME8|DI195_ORYSJ Protein DEHYDRATION-INDUCED 19 homolog 5 O... 30 6.1
sp|Q9NYW3|TA2R7_HUMAN Taste receptor type 2 member 7 OS=Homo sap... 29 8.0
sp|Q646A2|TA2R7_GORGO Taste receptor type 2 member 7 OS=Gorilla ... 29 8.0
sp|P97690|SMC3_RAT Structural maintenance of chromosomes protein... 29 8.0
sp|Q5R4K5|SMC3_PONAB Structural maintenance of chromosomes prote... 29 8.0
sp|Q9CW03|SMC3_MOUSE Structural maintenance of chromosomes prote... 29 8.0
sp|Q9UQE7|SMC3_HUMAN Structural maintenance of chromosomes prote... 29 8.0
sp|O97594|SMC3_BOVIN Structural maintenance of chromosomes prote... 29 8.0

>sp|Q6P5F6|S39AA_MOUSE Zinc transporter ZIP10 OS=Mus musculus
GN=Slc39a10 PE=1 SV=1
Length = 833

Score = 33.9 bits (76), Expect = 0.33
Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 4/70 (5%)
Frame = +1

Query: 1 NIALGSSY*CLKLVKRDETNKSKTEISDLSALAVPYEKKTHTHTQFYFENHL----YTFF 168
N+ LG +K+V+ + + +S L LAV K H+HT +F NHL +T
Sbjct: 88 NLGLGE----IKVVEINHEDLGHDHVSHLDILAVQEGKHFHSHTHQHFHNHLNAENHTTT 143

Query: 169 VTTPRGIHTC 198
T + H C
Sbjct: 144 SVTSKRNHKC 153


>sp|Q54PT3|C556A_DICDI Probable cytochrome P450 556A1
OS=Dictyostelium discoideum GN=cyp556a1 PE=3 SV=1
Length = 657

Score = 33.1 bits (74), Expect = 0.56
Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 5/56 (8%)
Frame = +1

Query: 73 EISDLSALAVPYEKKTHTHTQFYFENHLYTFFVTTPR-----GIHTCSFRCKDDIQ 225
EI D++A+ Y +K++ ++ ++ N F +T I+ C+F CKD +Q
Sbjct: 81 EIKDINAIQYVYNEKSNNYSLYWNLNKSSNFILTGSEIKRFFRIYYCAFNCKDSLQ 136


>sp|Q8NF91|SYNE1_HUMAN Nesprin-1 OS=Homo sapiens GN=SYNE1 PE=1 SV=2
Length = 8797

Score = 31.2 bits (69), Expect = 2.1
Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
Frame = -3

Query: 444 MRQRDLELLEKLRKQAEKFEKIKRVLAEYKEGHKMLEYWL--QNTKLDKY 301
+++R + E+ ++ K EK+ R+ EY+ K E WL + KLD+Y
Sbjct: 3469 LQERYRAIQERAKEAVTKSEKLVRLHQEYQRDLKAFEVWLGQEQEKLDQY 3518


>sp|Q96AA8|JKIP2_HUMAN Janus kinase and microtubule-interacting
protein 2 OS=Homo sapiens GN=JAKMIP2 PE=2 SV=1
Length = 810

Score = 30.8 bits (68), Expect = 2.8
Identities = 14/49 (28%), Positives = 35/49 (71%)
Frame = -3

Query: 438 QRDLELLEKLRKQAEKFEKIKRVLAEYKEGHKMLEYWLQNTKLDKYEQK 292
+R+ ELLEK+ KQ + ++++ L + ++ +++LE+ +N +L++ E++
Sbjct: 551 KRNQELLEKIEKQEAENHRLQQELQDARDQNELLEF--RNLELEERERR 597


>sp|Q646F6|TA2R7_PAPHA Taste receptor type 2 member 7 OS=Papio
hamadryas GN=TAS2R7 PE=3 SV=1
Length = 317

Score = 30.4 bits (67), Expect = 3.6
Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 9/89 (10%)
Frame = +2

Query: 95 WQCHMKK-KHTHTHNSILRITYIHFL*QLLEVFILVL--------LGAKTTSKGGTLTPP 247
W C + K +H T + +T + F L+ F+L+L + T T
Sbjct: 170 WSCRVTKAQHASTKLFLNLVTLLPFSVCLVSFFLLILSLWRHIRRMQLSATGCRDPSTEA 229

Query: 248 HVRGLPTYLLAMHIHFCSYLSSLVFWSQY 334
HVR L + + + YLS L+ S Y
Sbjct: 230 HVRALKAVISFLFLFIAYYLSFLIATSSY 258


>sp|Q645T7|TA2R7_MACMU Taste receptor type 2 member 7 OS=Macaca
mulatta GN=TAS2R7 PE=3 SV=1
Length = 318

Score = 30.0 bits (66), Expect = 4.7
Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 9/89 (10%)
Frame = +2

Query: 95 WQCHMKK-KHTHTHNSILRITYIHFL*QLLEVFILVL--------LGAKTTSKGGTLTPP 247
W C + K +H T + +T + F L+ F+L+L + T T
Sbjct: 170 WSCRVTKAQHASTKLFLNLVTLLPFSVCLMSFFLLILSLWRHIRRMQLSATGCRDPSTEA 229

Query: 248 HVRGLPTYLLAMHIHFCSYLSSLVFWSQY 334
HVR L + + + YLS L+ S Y
Sbjct: 230 HVRALKAVISFLLLFIAYYLSFLIATSSY 258


>sp|B2KIE9|SEPT8_RHIFE Septin-8 OS=Rhinolophus ferrumequinum
GN=SEPT8 PE=3 SV=1
Length = 429

Score = 30.0 bits (66), Expect = 4.7
Identities = 15/30 (50%), Positives = 21/30 (70%)
Frame = -3

Query: 444 MRQRDLELLEKLRKQAEKFEKIKRVLAEYK 355
+++ +LEL EK R+ EKFE +KRV E K
Sbjct: 352 VKETELELKEKERELHEKFEHLKRVHQEEK 381


>sp|B5FW69|SEPT8_OTOGA Septin-8 OS=Otolemur garnettii GN=SEPT8 PE=3
SV=1
Length = 442

Score = 30.0 bits (66), Expect = 4.7
Identities = 15/30 (50%), Positives = 21/30 (70%)
Frame = -3

Query: 444 MRQRDLELLEKLRKQAEKFEKIKRVLAEYK 355
+++ +LEL EK R+ EKFE +KRV E K
Sbjct: 352 VKETELELKEKERELHEKFEHLKRVHQEEK 381


>sp|Q92599|SEPT8_HUMAN Septin-8 OS=Homo sapiens GN=SEPT8 PE=1 SV=4
Length = 483

Score = 30.0 bits (66), Expect = 4.7
Identities = 15/30 (50%), Positives = 21/30 (70%)
Frame = -3

Query: 444 MRQRDLELLEKLRKQAEKFEKIKRVLAEYK 355
+++ +LEL EK R+ EKFE +KRV E K
Sbjct: 352 VKETELELKEKERELHEKFEHLKRVHQEEK 381


>sp|B1MTN8|SEPT8_CALMO Septin-8 OS=Callicebus moloch GN=SEPT8 PE=3
SV=1
Length = 429

Score = 30.0 bits (66), Expect = 4.7
Identities = 15/30 (50%), Positives = 21/30 (70%)
Frame = -3

Query: 444 MRQRDLELLEKLRKQAEKFEKIKRVLAEYK 355
+++ +LEL EK R+ EKFE +KRV E K
Sbjct: 352 VKETELELKEKERELHEKFEHLKRVHQEEK 381


tr_hit_id B8AW37
Definition tr|B8AW37|B8AW37_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica
Align length 33
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917504|Adiantum capillus-veneris mRNA, clone:
YMU001_000101_F06.
(449 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8AW37|B8AW37_ORYSI Putative uncharacterized protein OS=Oryza... 34 4.2
tr|A3B268|A3B268_ORYSJ Putative uncharacterized protein OS=Oryza... 34 4.2
tr|B3LCG8|B3LCG8_PLAKH Putative uncharacterized protein OS=Plasm... 34 4.2
tr|B8ABW0|B8ABW0_ORYSI Putative uncharacterized protein OS=Oryza... 33 5.5
tr|A5ZG93|A5ZG93_9BACE Putative uncharacterized protein OS=Bacte... 33 7.2
tr|A0C348|A0C348_PARTE Chromosome undetermined scaffold_146, who... 33 7.2
tr|Q89ZQ6|Q89ZQ6_BACTN Putative zinc protease OS=Bacteroides the... 33 9.4
tr|A5ZXR7|A5ZXR7_9FIRM Putative uncharacterized protein OS=Rumin... 33 9.4
tr|A5JZY2|A5JZY2_PLAVI Putative uncharacterized protein OS=Plasm... 33 9.4
tr|A0CE54|A0CE54_PARTE Chromosome undetermined scaffold_170, who... 33 9.4
tr|A0BLK0|A0BLK0_PARTE Chromosome undetermined scaffold_114, who... 33 9.4

>tr|B8AW37|B8AW37_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_19300 PE=4 SV=1
Length = 171

Score = 33.9 bits (76), Expect = 4.2
Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 2/33 (6%)
Frame = +1

Query: 196 CSFRCKDDIQG--WNPHPTPRKRAPNLFVGYAH 288
CS R +DD +G W P P P +R P V YAH
Sbjct: 21 CSVRWRDDSRGFLWYPAPRPPRRGPLAIVVYAH 53


>tr|A3B268|A3B268_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_017140 PE=4 SV=1
Length = 156

Score = 33.9 bits (76), Expect = 4.2
Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 2/33 (6%)
Frame = +1

Query: 196 CSFRCKDDIQG--WNPHPTPRKRAPNLFVGYAH 288
CS R +DD +G W P P P +R P V YAH
Sbjct: 21 CSVRWRDDSRGFLWYPAPRPPRRGPLAIVVYAH 53


>tr|B3LCG8|B3LCG8_PLAKH Putative uncharacterized protein
OS=Plasmodium knowlesi (strain H) GN=PKH_143450 PE=4
SV=1
Length = 923

Score = 33.9 bits (76), Expect = 4.2
Identities = 37/117 (31%), Positives = 54/117 (46%), Gaps = 19/117 (16%)
Frame = +2

Query: 155 YIHFL*QLLEVFILVLL--GAKTTSKGGTLTPPHVRGLP-TYLLAMH----IHFCSYLSS 313
YI+ L +LL F L L G + + P +RGL +Y L +H F SYLS
Sbjct: 208 YIYLL-RLLPKFCLPLYDSGILQYACEDPILNPKLRGLEISYRLLVHDILFYAFFSYLSD 266

Query: 314 LVFWSQ----------YSSIL*PSLYSA--STRLIFSNFSACLRNFSKSSKSLCLMY 448
L FW++ Y S+ + Y + + RL+F N L NFS + + L+Y
Sbjct: 267 LPFWAKPPIELLRIYNYESLYSFNDYESEHTERLVFHNIKNILYNFSDTLNKIELLY 323


>tr|B8ABW0|B8ABW0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_02870 PE=4 SV=1
Length = 195

Score = 33.5 bits (75), Expect = 5.5
Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 2/33 (6%)
Frame = +1

Query: 196 CSFRCKDDIQG--WNPHPTPRKRAPNLFVGYAH 288
CS R +DD +G W P P P +R P V YAH
Sbjct: 21 CSARWRDDSRGFLWYPAPRPPRRGPLAIVVYAH 53


>tr|A5ZG93|A5ZG93_9BACE Putative uncharacterized protein
OS=Bacteroides caccae ATCC 43185 GN=BACCAC_01911 PE=4
SV=1
Length = 945

Score = 33.1 bits (74), Expect = 7.2
Identities = 21/47 (44%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
Frame = -3

Query: 429 LELLEKLRKQ---AEKFEKIKR-VLAEYKEGHKMLEYWLQNTKLDKY 301
+E LEK+ K+ AE +KIK +L +YK+ K YWL N LD+Y
Sbjct: 853 VEQLEKMAKEGPSAEHMQKIKEYMLKKYKDAQKENGYWLNN--LDEY 897


>tr|A0C348|A0C348_PARTE Chromosome undetermined scaffold_146, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00034693001 PE=4 SV=1
Length = 547

Score = 33.1 bits (74), Expect = 7.2
Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 1/37 (2%)
Frame = -3

Query: 441 RQRDLELLEKLRKQAEKFEKIKRVL-AEYKEGHKMLE 334
R+R +LLE +KQAEKFEKI++ L A+ + K LE
Sbjct: 240 RERQKKLLEDKKKQAEKFEKIRKKLEADELQQKKELE 276


>tr|Q89ZQ6|Q89ZQ6_BACTN Putative zinc protease OS=Bacteroides
thetaiotaomicron GN=BT_4320 PE=3 SV=1
Length = 946

Score = 32.7 bits (73), Expect = 9.4
Identities = 21/47 (44%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
Frame = -3

Query: 429 LELLEKLRKQ---AEKFEKIKR-VLAEYKEGHKMLEYWLQNTKLDKY 301
+E LEK+ K+ AE +KIK +L +YK+ K YWL N LD+Y
Sbjct: 853 IEQLEKMAKEGPSAEHMQKIKEYMLKKYKDAQKENGYWLGN--LDEY 897


>tr|A5ZXR7|A5ZXR7_9FIRM Putative uncharacterized protein
OS=Ruminococcus obeum ATCC 29174 GN=RUMOBE_03823 PE=4
SV=1
Length = 217

Score = 32.7 bits (73), Expect = 9.4
Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
Frame = +2

Query: 185 VFILVLLGAKTTSKGGTLTPPHVRGLPTYLLAMHIHFCSYLSS----LVFWSQYSSIL*P 352
+F+LV LG T GG L + G+P Y+L HI+ C+ + +V + + +++
Sbjct: 131 MFLLVFLGT-ITGVGGGLLRDIMAGVPPYILVRHIYACASIVGAIVCVVLYRNFGAVV-- 187

Query: 353 SLYSASTRLIFSNFSA 400
S+ AS +I + A
Sbjct: 188 SMVGASAVVILVRYLA 203


>tr|A5JZY2|A5JZY2_PLAVI Putative uncharacterized protein
OS=Plasmodium vivax GN=PVX_123545 PE=4 SV=1
Length = 960

Score = 32.7 bits (73), Expect = 9.4
Identities = 36/117 (30%), Positives = 54/117 (46%), Gaps = 19/117 (16%)
Frame = +2

Query: 155 YIHFL*QLLEVFILVLL--GAKTTSKGGTLTPPHVRGLP-TYLLAMH----IHFCSYLSS 313
YI+ L +LL F L L G + + P +RGL +Y L +H F SYLS
Sbjct: 206 YIYLL-RLLPKFCLPLYDSGILQYACEDPILNPKLRGLELSYRLLVHDILFYAFFSYLSD 264

Query: 314 LVFWSQ----------YSSIL*PSLYSA--STRLIFSNFSACLRNFSKSSKSLCLMY 448
L FW++ Y S+ + Y + + RL+F N L NF+ + + L+Y
Sbjct: 265 LPFWAKPPVELLRIYNYESLYSFNDYESEHTERLVFHNIKNILYNFADTLNKIELLY 321


>tr|A0CE54|A0CE54_PARTE Chromosome undetermined scaffold_170, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00037507001 PE=4 SV=1
Length = 536

Score = 32.7 bits (73), Expect = 9.4
Identities = 15/27 (55%), Positives = 21/27 (77%)
Frame = -3

Query: 441 RQRDLELLEKLRKQAEKFEKIKRVLAE 361
R++ +LLE +KQAEKFEKI++ L E
Sbjct: 229 REKQRKLLEDKQKQAEKFEKIRKKLEE 255